Conserved Protein Domain Family
RhoGEF67_u1

?
pfam16615: RhoGEF67_u1 
Unstructured region one on RhoGEF 6 and 7
RhoGEF67_u1 is a region of natively unstructured residues on Rho guanine nucleotide exchange factor 6 and 7 proteins. The function is not known. It lies between the CH and the SH3 domains.
Statistics
?
PSSM-Id: 318756
View PSSM: pfam16615
Aligned: 16 rows
Threshold Bit Score: 47.4888
Threshold Setting Gi: 1040663113
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 637358324  114 PSARPCSRLSPARSPSEDCPPSRKTTSPKSPRALRRQSKAVDMTENGG 161
gi 733898998  114 PSEGPCSHPSALSSAAGGAHTDSNSTASQSAKVLRRQSKAVEMTENGS 161
gi 537132635  137 lSERPCGRSSSLSA-TNNSPTNPQATVPSTTPAQQSQAKAVEMTENGS 183
gi 109745507  115 GSNSVCSRQSSSLRIKSFDSLNCSSTHRRSSRHKFNQYRSLDMSENSA 162
gi 47225326   114 APERSCSQSGASS--PSQSTASHSLSSTKSKGSLRRQSKSVEMSENGG 159
gi 830005628  114 lSERPCGRS-SSLSAANSSQTNPQGAISSTAPGLQRQSKAVEMTENGS 160
gi 432877882  114 AAER-CPQSASSS--PNQATSLQTQGSIKSKGSLRRQSKSVEMSENGG 158
gi 583971738  114 AAER-CPQSGTPS--PSQAS-SHTLSSAKSKGSLRRQSKSVEMSENGG 157
gi 1019070072 114 PSEKPCRRSSSLS--APSSQTYLKRVSSNTGSVLRRQSKA-EMTENGS 158
gi 1040663113  64 S--RSCPQSNTST--SSLSTPSQAAPTLKSSRSLRRQSKAVEMSENGG 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap