1UEC


Conserved Protein Domain Family
NECFESHC

?
pfam16621: NECFESHC 
Click on image for an interactive view with Cn3D
SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
NECFESHC is the C-terminal domain of the second SH3 domain found on neutrophil cytosol factor 1 or p47phox proteins in higher eukaryotes. It is not unstructured as illustrated by the structure of Structure 1ng2.
Statistics
?
PSSM-Id: 318762
View PSSM: pfam16621
Aligned: 19 rows
Threshold Bit Score: 66.9882
Threshold Setting Gi: 672072810
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
1UEC_A       135 KSGQDVSQAQRQIK-RGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVR 183
gi 597762794 285 GEKKEVEAEKDIMRrETPPPRRSTIRNAQSIHAKGRQRISQDTYRRQSRR 334
gi 71834304  286 GEKKEVDAERDVVRrATPPPRRSTIRNAQSIHSTVRRRISQDSYRKQSRR 335
gi 941807942 283 KSDSKNETDRTNLRgQRPPPRRSTIRNAKSIHSKSRQKLSQDAYRRNSRR 332
gi 432962084 283 KASKRIQTLRTNLHgQRPPPRRSTIKNAKSIHNRSRQRLSQEAYRRNSRR 332
gi 74096349  285 NKREQSESSRANVQgHKPPPRRSTIRNAKSIHNKSRQRLSQDTYRRNSRR 334
gi 47221420  286 SKRAQAEAARNHLQgQKPPPRRSTIRNAKSIHNKSRQRLSQDAYRRNSRR 335
gi 736215005 285 GKREIYEAQRTNLQgQKPPPRRSTIRNAKSIHNKSRQRLSQDTYRRNSRR 334
gi 483515332 268 RSGEPNTPEKSELRnRSVPPRRSTIRNAKSIHKQSRKQISQETYRRNSKK 317
gi 525017854 282 KAGEVDTSVKSELRnRGAPPRRSTIRNVKSIHRQGRKQISQETYRRNSKK 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap