Conserved Protein Domain Family
Arm_APC_u3

?
pfam16629: Arm_APC_u3 
Armadillo-associated region on APC
Arm_APC_u3 is a semi-unstructured region lying immediately downstream of the armadillo fold before the beta-catenin binding motifs, APC_crr, pfam05923, on APC or adenomatous polyposis coli proteins in higher eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318770
View PSSM: pfam16629
Aligned: 5 rows
Threshold Bit Score: 477.567
Threshold Setting Gi: 219802769
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301613942  734 NRPAKYKDANIMSPGSSVPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKTTHRNKQRHKQNLCSEYVLDSSRH-DDSI 812
gi 972955122  738 NRPAKYKDANIMSPGSSLPSLHARKQKALIEELDAQHLSETFDNIDNLSPKASHRSKPRHKQNVYSEYVLDSGRHnDDGL 817
gi 219802769  726 NRPAKYKDANIMSPGSSLPSLHVRKQKALIEELDAQHLSETFDNIDNLSPKASHRVKPRHKHNVYGDY---------DAV 796
gi 733926242  163 NRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRNKQRHKQNVYSEYVLDSNRH-DDGV 241
gi 291289167  262 NRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYAFDANRH-DDN- 339
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301613942  813 CRSDNFSLGNLTVLSPYINSTVLPGSSS--PRPtmEGNRPEKDR----E-RTAGLSNYHSATENsgnSSKRIGVQLSTT- 884
gi 972955122  818 CRPESFNPNNITVLSPYMNTPVLSSSSSrdSRGnsEGSRAEKDRsldrErRGAGPGGFHPSTDN---TSKRIGMQISTTa 894
gi 219802769  797 CRSDGYNPNGVGVRSPYMNTPVLSSPSSrdNRGnaESVRAERDRsldrErRG-----FLPDGE----AAKRM-MQIPTSa 866
gi 733926242  242 CRTESFSTGNVTVLSPYLNSTVLPGSSSs-SRGniENCLSEKDRsldrD-RAVGLNAYHPATENsgnSSKRVGMQISTAa 319
gi 291289167  340 -RSDNFNTGNMTVLSPYLNTTVLPSSSS--SRGslDSSRSEKDRslerE-RGISIGNYHPATENpgtSSKR-GLQISTTa 414
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301613942  885 AQISKVMDEVSNIHMVQEDRSSGSASEMHCMSDERTSQRKPSSnHPHSNPFSFAKGDSSNRGCPVAFMKMEYKmASNDSL 964
gi 972955122  895 AQIAKVMEEVQSMHISQEERPVGTSTDIHCMQEDISGIRRSST-HTHSNVYAFNKPEHPNRTCPMPYVKMEYR-ASNDSL 972
gi 219802769  867 AQIAVVMEEVQNMHLGMDDRSAGSTPDPHSVQDDM--IRRQTAvHGHQNIYSYSKTDPSGRPCPMP--KLEYR-ASNDSL 941
gi 733926242  320 AQIAKVMEEVTSMHIPQEDRGSSSPSEMHCLTEDRNTTRRAASaHTHSNTY-FPKSENSSRPCPVPYTKMEYKrASNDSL 398
gi 291289167  415 AQIAKVMEEVSAIHPSQEDRNSGSTTELHCGTDERNALRRSSTaHSHANTYNFTKSENSNRTCPMPYAKVEYKrSSNDSL 494
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 301613942  965 NSVSSTDGYGKRGQVKPSVESYSEDDEGKFGSYGHYPAGLAHKIHSANHMDDND 1018
gi 972955122  973 NSVSSSDGYGKRGQMKPSVDSYSEDDEGKFCSYGKYPADLAHKIHSANHMEDND 1026
gi 219802769  942 NSVNSTDGYGKRGQMKPSVDSYSEDDEGKCCVYRKYPADLAHKIHNANHMEDDN 995
gi 733926242  399 NSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDND 452
gi 291289167  495 NSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDND 548
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap