Conserved Protein Domain Family
APC_u9

?
pfam16633: APC_u9 
Unstructured region on APC between 1st two creatine-rich regions
APC_u9 is a short region of natively unstructured sequence lying between the first and second APC_crr, pfam05923, domains on APC or adenomatous polyposis coli proteins in higher eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318774
View PSSM: pfam16633
Aligned: 9 rows
Threshold Bit Score: 115.369
Threshold Setting Gi: 219802769
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301613942 1288 AEDEIeGRERSSRGQESNNTLQITEPKENKSAVSKDGAINETRSSVHHTRTKNNRLQTSNISPSDSSR-HKSVEFSSGAK 1366
gi 395514172 1189 AEDEI-GRDQTTRGTETSNNLQIAELKENSGSVSTDDTISEVPSTSQHIRTKANRLQTTSLSPSDSAR-HKAVEFSSGAK 1266
gi 637318253 1282 AEDET-GRDQATRVADADSSLKIGRIKENSGNLSAAGTVIETSSATQHIRTKSNRLQASSLSPSDSAR-HKTVEFSSGAK 1359
gi 972955125 1271 AEDEMeGREQPRSSANNYPTLPIVD-KEASGVLS-EQPVAEGQSSSQYMRMKPHRNQASNVATSDGSR-HKAVEFSSGAK 1347
gi 219802769 1257 EEDEMeSCKRNVNSASNYPTLPISE-KQSTNNVAADQRTSESQSSVHYVRAKPPRH---HLGHGDGSRhHKTVEFSSGAK 1332
gi 637318263 1223 AEDET-GRDQATRVADADSSLKIGRIKENSGNLSAAGTVIETSSATQHIRTKSNRLQASSLSPSDSAR-HKTVEFSSGAK 1300
gi 733926242  718 AEDEI-GRDQSTRVTDTNNTLQIAELKEDSGALSAEAAVNEITSTSQHIRTKSSRLPASSLSPSDSSR-HKAVEFSSGAK 795
gi 344265975 1282 AEDEI-GCDQTTQETDSANTLQIAELKENSGTRSTEETVSEVPAVSQHIRTKSNRLQASGLSSSESTR-HKAVEFSSGAK 1359
gi 612035593 1193 AEDEI-GRDQTTRGSETTNTLQIAELKENSASVSTGDTGSEVPSTSQHIRTKANRLQTTSLSPSDSTR-HKAVEFSSGAK 1270

                  ....*....
gi 301613942 1367 SPSKSGAQT 1375
gi 395514172 1267 SPAKSGAQT 1275
gi 637318253 1360 SPSKSGAQT 1368
gi 972955125 1348 SPSKSGAQT 1356
gi 219802769 1333 SPSKSGAQT 1341
gi 637318263 1301 SPSKSGAQT 1309
gi 733926242  796 SPSKSGAQT 804
gi 344265975 1360 SPSKSGAQT 1368
gi 612035593 1271 SPAKSGAQT 1279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap