Conserved Protein Domain Family
APC_u14

?
pfam16635: APC_u14 
Unstructured region on APC between SAMP and APC_crr
APC_u14 is a short region of natively unstructured sequence lying between the second SAMP pfam05924, and the fifth creatine-rich region, APC_crr, pfam05923, on APC or adenomatous polyposis coli proteins in higher eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318776
View PSSM: pfam16635
Aligned: 10 rows
Threshold Bit Score: 133.819
Threshold Setting Gi: 301613942
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513231326 1763 IMDQIQQAST---SLNNKNQPEGEKKKPTSPVKPVPQNSEYRARVRKNTESKSQINNERSYPE-NRDAKKQNLKNNSRDF 1838
gi 149642301 1751 IMDQVQQASAa-sSGSSISQPDGERKKPTSPVKPMPQSIEYRARVKKNADSKNNFNMERSYTD-HKEAKKQNLKNHSRDF 1828
gi 395514172 1652 IMDQIQQASTs-sSGNSKSPLDNEKKKPTSPVKPMPQSVEYRTRIRKNAESK-NLNIERSYSD-NKDSKKLNLKNNPRDF 1728
gi 972955125 1725 IIDQVQHTSA---SPGSPGPQDSEKKKPTSPVKPMPQSSGYRARVMKRAEPTNTCPPEGSFSDkNKEVKKRDPKTASREY 1801
gi 992211941 1684 MSDQPQHPPT---ATGSLVQQDFEKKKPTSPVKPMPQSSEYRLRMLKRQDAPGNLSEATAYPDkNAESKKFEARVGPREF 1760
gi 301613942 1750 IMDQINHTSAgtsSGNNRSMQEIDKNKPTSPVKPMPQSIEFKGRLKKNTESKLNPSSENQYSD----PRKQNSKNTSKDA 1825
gi 961730593 1748 IMDQVQQASMs-sSGANKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNTDSKNNLNAERTFSD-NKDSKKQNLKNNSKDF 1825
gi 637318253 1747 IMDQIQQASPp-sSVSNKNQLEVEKKKPTSPVKPMPQSNEYRARLRKNTEPKNNFNSERTYTD-NKDTKKQNLKNNSRDF 1824
gi 528491243 1703 MPDQAQHPST---ATGSLVQQDLEKKKPTSPVKPMPQSSEYRARMLKRPEANNSLADPATYPDkNKETRKQEPKVVIRDF 1779
gi 513231342 1736 IMDQIQQAST---SLNNKNQPEGEKKKPTSPVKPVPQNSEYRARVRKNTESKSQINNERSYPE-NRDAKKQNLKNNSRDF 1811
                          90
                  ....*....|....*.
gi 513231326 1839 NDKLPNNEERVRGSFT 1854
gi 149642301 1829 NDKLPNNEDRVRGSYA 1844
gi 395514172 1729 IDKLPNNEERVRGSFT 1744
gi 972955125 1802 TNKPPGSEERIRGSFA 1817
gi 992211941 1761 SDKPVNAEERTRPGYT 1776
gi 301613942 1826 NEKIPNNEERTKGfaf 1841
gi 961730593 1826 NDKLPNNEDRVRGSFT 1841
gi 637318253 1825 NDKPPNNEERTRGSFA 1840
gi 528491243 1780 ADKPSNAEERTRPGFA 1795
gi 513231342 1812 NDKLPNNEERVRGSFT 1827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap