4OE8


Conserved Protein Domain Family
IL23

?
pfam16649: IL23 
Click on image for an interactive view with Cn3D
Interleukin 23 subunit alpha
This family, interleukin 23 subunit alpha, is a heterodimer consisting of a 40 kDa subunit - p40 - that is shared with IL12 and a unique 19 kDa subunit - p19. IL23 is a pro-inflammatory cytokine that binds to adnectins and thus plays a key role in the pathogenesis of several autoimmune and inflammatory diseases. IL23 signalling on the cell membrane works through the interaction of four proteins, two of which are shared with the IL12-receptor complex; signalling through the cell membrane involves the combined aggregation of at least two receptor components and then the subsequent activation of the Jak/Tyk tyrosine kinases and the family of STAT transcription factors.
Statistics
?
PSSM-Id: 318789
View PSSM: pfam16649
Aligned: 6 rows
Threshold Bit Score: 291.871
Threshold Setting Gi: 81881842
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OE8_B        28 PAWTQCQQLSQKLCTLAWSAHPLVGHMDL-REEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGS 106
gi 81863825   28 PSWTQCQQLSQKLCTLAWSAHPSVGHVEPpREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGS 107
gi 13752579   28 PDWAQCQQLSRNLCMLAWNAHAPAGHMNLlREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDS 107
gi 329664190  30 PAWTRGQQLSQQLCMLAWSAHLPMGHVDLpREEGGDKTTDDVPRIQCEDGCDPQGLRDNSQSCLQRIHRGLVFYEKLLGS 109
gi 302564826  28 PAWAQCQQLSQKLCTLAWSAHPLVGHMDL-REEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGS 106
gi 81881842   28 PDWAQCQQLSRNLCMLAWNAHAPAGHMNLlREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDS 107
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
4OE8_B       107 DIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWEtQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGA 184
gi 81863825  108 DIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWE-PQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGA 184
gi 13752579  108 DIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPREtQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGA 185
gi 329664190 110 DIFTGEPSLLPNGPVDQLHASILGLRELLQPKGHHWEtEQTPSPIPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGA 187
gi 302564826 107 DIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWEtQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGA 184
gi 81881842  108 DIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPREtQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGA 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap