3WGY,1DAP


Conserved Protein Domain Family
DAPDH_C

?
pfam16654: DAPDH_C 
Click on image for an interactive view with Cn3D
Diaminopimelic acid dehydrogenase C-terminal domain
This family comprises the C-terminal domain of diaminopimelic acid dehydrogenase. Diaminopimelate dehydrogenase is a NADPH-dependent enzyme that catalyzes the oxidative deamination of meso-2,6-diaminopimelate, which is the direct precursor of L-lysine in bacterial lysine biosynthesis.
Statistics
?
PSSM-Id: 318792
View PSSM: pfam16654
Aligned: 66 rows
Threshold Bit Score: 248.624
Threshold Setting Gi: 502953936
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WGY_B       122 GWDPGLFSLNRLLGESILPKGKTHTFWGKGVSLGHSDAIRRVQGVKNGIQYIIPIKGALDKARSGEQC-DFTTREKHEMV 200
1DAP_B       118 GWDPGMFSINRVYAAAVLAEHQQHTFWGPGLSQGHSDALRRIPGVQKAVQYTLPSEDALEKARRGEAG-DLTGKQTHKRQ 196
gi 504398906 123 GWDPGLFSLIRLLEEAVLPEGTDYTFWGPGVSQGHSDAVRRVEGVRDARQYTIPIEDTVARVRSGEAP-SLSTRERHLRR 201
gi 524334442 127 GWDPGLFSLSRMLAEALLPCGESYTFWGRGISQGHSDAVRSIEGILDARQYTIPKEDVLKKIRTGEICnALSDRQCHRRE 206
gi 644259468 119 GWDPGLFSMLRVLGEAVLPTGTTTTFWGPGVSQGHSDAIRRIPGVVDARQYTVPVEETVAAVKERRDV-ELTPRTMHQRV 197
gi 503434600 118 GWDPGLFSLNRLLAETILPQGQTYTFWGRGVSQGHSDAVRRVDGVKAAIQYTVPNQAMLEAAKAGDPI-DYQQATAHSRE 196
gi 738433745 117 GWDPGLFSVNRVLGAALFPQPQQNTFWGKGLSQGHSDAVRRVPGVRRGVQYTIPSEEAIAEARAGRGA-EITGASAHVRE 195
gi 501329528 118 GWDPGMFSLNRVYAAAVLPGAQQNTFWGPGLSQGHSDALRRIEGVASAVQYTLPAEEALDKARRGEAE-GITGKNAHKRQ 196
gi 505214713 121 GWDPGMFSLNRTLAKAILPTAQQHTFWGPGLSQGHSDALRRIEGVRKAVQYTIPSEDALGSARRGEAG-DLDGKQAHVRR 199
gi 529146149 118 GWDPGMFSLNRTIADALLPGNEQHTFWGPGLSQGHSNAVRRIDGVQKAVQYTLPDEDSLELARQRKAG-DLDGKSAHVRK 196
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3WGY_B       201 CYVVPe--ENADLKKIEQDIKTMPDYFADYN-TTVHFITEEELKLNHAGLSNGGFVIRSGNTQGG-AkQVMEFNLNLE 274
1DAP_B       197 CFVVA---DAADHERIENDIRTMPDYFVGYE-VEVNFIDEATFDSEHTGMPHGGHVITTGDTGGF-N-HTVEYILKLD 268
gi 504398906 202 CYVVAe--EGADPGEIREKIRSMPNYFADYD-TKVSFISQEEMERSHNRMPHGGFVMRAGKTADG-TgHVLEFRLKLD 275
gi 524334442 207 CFVVCe--DGGNPKKIRRKILHMPDYFEGYE-TEVHFISQEELQEKHSKMPHGGTVIRVGKTGGE-NkAVYDFSLKMD 280
gi 644259468 198 CYVVAe--EGADLAAIERVIVEMPNYFADYD-TTVNFVSAAELAAEHSGIPHGGQVIRTGQTDDA-VgETITFGLDLD 271
gi 503434600 197 VYAVLe--EGADPDQVAKAIKTMPDYFAPYDqVDVHFISQEELDQNHQGIPHGGEVVRQGQTSAD-HhAVYNFALQLG 271
gi 738433745 196 CYVVAd--E-ADHAAITEAITTMPDYFAPYE-TTVHFISEEEFERDHQGMPHGGHVVTSGDLG-G-SrSAVEFVLELE 267
gi 501329528 197 CFVVPesdDAALKERIENDIRTMPDYFVGYE-VEVNFISQEEFDKNHTGMPHGGHVITTGELGATrThHTVEYTLELD 273
gi 505214713 200 CFVVC---DAADEERIENEIRTMPDYFVGYQ-VEVNFIDEATFDAEHTGMPHGGHVVTAGDTGGF-T-QSIEYTLELE 271
gi 529146149 197 CFIVAd--E-ADHERIEHEIRTMEDYFVGYQ-VEVTFVDEATFDAEHTGMPHGGHVITAADTGGF-N-HTIEYILKLE 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap