4ABN


Conserved Protein Domain Family
TTC5_OB

?
pfam16669: TTC5_OB 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat protein 5 OB fold domain
This OB fold domain is located at the C-terminus of Tetratricopeptide repeat protein 5 and is required for effective p53 response.
Statistics
?
PSSM-Id: 318805
View PSSM: pfam16669
Aligned: 41 rows
Threshold Bit Score: 105.727
Threshold Setting Gi: 358338759
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ABN_A       352 TLELKPLSTLQPGVNSGT----VVLGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNVVQSWGVLIGDSVAIPEPNLRH 427
gi 761903489 304 enKVCSIRELREGKESETedggVLIAAVASSFTTDERVPIACVIIDSAGDSIGLTLYNLIHNYQFAVGDILTIPKPTLSH 383
gi 514699701 281 gtTCCCIDDLQQGDNSGK----TLVVKSI-TILTREPMPQLFLVLDQRGQFACLSVYN-ARDNVLLAGDVLTIKDPVRRD 354
gi 695053287 299 SHGKATVNVLKEGLNKAV----AIIGKVLLFIKHENVAPLYYLICDSDQTCFVLSVYGL-HSDAIKEGDRVILMEPHYRV 373
gi 947087090 236 SYRRVTIDLLSEGPNRAL----ALEGKVFFFVRSESVAPLYYLLCDSNQSCFVLSIYGV-RTDVIKEGDQLTLLDPYFRD 310
gi 566190489 316 SYKRASVDQLSEGLNRAV----AIVGKVLFFVKQENATPLYYLVCDSNQICFVLSVYGM-RNDAIKEGDQLTLLEPYYHY 390
gi 723668371 429 SYKRATVDLLTEGFNEQI----EVVAAVRCLVKYEYKAPVYYMLCDSDENSFVLAVFGI-QKEAIKQGDQVTLLDPICKF 503
gi 971585085 377 SYNRATLDVLAEGPNKGL----AVIGAVRCLVKYEYSTPLYYVLCDSNENSFVLTVFGI-QKEAIKQGDQVTLLEPFCKF 451
gi 460386358 301 SYKRATMDLLSEGLNKGI----AVTGKVLFFAKKESVAPLCYVLSDSNHTCSVITVYGI-RSDAIKEGDQVTLLEPFYRF 375
gi 548846738 309 PYTMATLNLLRDGKNNGM----AVLGKVMVFIRLPFTSLPYFLLCDSDGTFFILSLYAL-SSNGVKNGDTVTLLNPNCRV 383
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
4ABN_A       428 HQirh-----------kgkDYSFSSVRVETPLLLVVNGKPQNSSSQAS 464
gi 761903489 384 ISipe-----------levEYD--SIRCVNPQTLMVNSNKISSDKLSS 418
gi 514699701 355 VDirgd---------eelgDVAYPSIRVELPTAITRNGRKLGRDTLVA 393
gi 695053287 374 IDfsw-----------kgtHYHFQSIRVDFVEQLLVNEKVPAPHHLVR 410
gi 947087090 311 VDlsw-----------kekRYQFKSIRLDFYEQVLVNGKALTPQQAIR 347
gi 566190489 391 VDfsw-----------kgkHYNFKSVRVDFTEQVLVNGKVLSSHHAVR 427
gi 723668371 504 VDfew-----------egkHYEFKSVRVNLLEQVLVNGNPLPPSSAMR 540
gi 971585085 452 VDfew-----------egkHYQFTSVRVNLVEQVLVNGNALSPSFAIR 488
gi 460386358 376 VDfsw-----------kgkHYQFKSVRVDFVEQLLVNGKNLSSHHAVR 412
gi 548846738 384 IDfswkgkfaillvsnakqEYRFKSIRVDRLGNILVNGSPPHSDHVRP 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap