Conserved Protein Domain Family
PI-PLC-C1

?
pfam16670: PI-PLC-C1 
Phosphoinositide phospholipase C, Ca2+-dependent
PI-PLC-C1 is a family of calcium 2+-dependent phosphatidylinositol-specific phospholipase C1 enzymes from bacteria and fungi. The enzyme classification number is EC:3.1.4.11. This enzyme is involved in part of the myo-inositol phosphate metabolic pathway.
Statistics
?
PSSM-Id: 318806
View PSSM: pfam16670
Aligned: 50 rows
Threshold Bit Score: 438.159
Threshold Setting Gi: 489081418
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81792991   50 RLTDLQYIGSHNSYHAGFAPSEATLLKqhd-paAFATLDYRHPPLTQQLDDGVRQLELDVFADAHGGRYAHPAIVEQIAK 128
gi 740742753  25 RINQLQVIGSHNSYKKEIEPKLYRFLEkkdttnSIQSLQYTHIPILEQLDMGLRNLEIDVYADSKGGTYANPKGLSLAQP 104
gi 503315429  24 KINQVQVIGSHNSYKQAIQPKLYKFLEnrdttgSLSGLQYTHVSIPKQLDLGLRNLEIDVHADSKGGSYTNPKGLSVASD 103
gi 502457933  25 KMNRIQVIGSHNSYKRAIDPALFKVFQqkd-svSASKLDYEHISIAEQLDMGLLNLEIDVYPDEKGGRFAHPKGLQWAPG 103
gi 495785566  25 PINKIQVIGSHNSYKRAIEPALFHLFQkkd-svSASKIDYEHISLTDQLDMGLLNLEIDVYSDEKGGRYAHPKGLEWVKG 103
gi 503982839  27 PINKIQVIGSHNSYKRAIDPALFKVLMekd-snRVKGLAYAHIPIEEQLKMGLNNLEIDCYRDEKGGKYAHPKGLDMVAG 105
gi 283816863  25 KLNQIQCIGSHNSYKQAIDPALFALLSrtd-slRFKAIEYSHISLTDQLNLGLQNLEIDVYADAKGGKYAHPMGLKLAKN 103
gi 505080467  31 QLNDIQVIGSHNSYKIGIEPKVMAIIAnmd-ssAAISLEYDHIPLNEQLELGLRNLELDVFHDPVGGRYSQPKALASLDS 109
gi 495477879  26 SINQTQVIGSHNSYKSEMSPSLLEYLSkvn-ptASQSLEYAHIPFEAQLDLGLRNLELDVFHDPEGGRYSNPKGLEIIKS 104
gi 503757559  29 KMNDFQVIGSHNSYKIAIEKPLFDYLWqk--npAMSGLEYGHIPLSKQLDLGLRGLELDVFHDPKGGHYSNPKGLEIIKS 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81792991  129 aglppapaSAPAGVMNKPGFKVLHVQDVDQRSTCQPLVTCLQEVRAWSQQHPGHLPIFILLETKQSPVqlsfptVQPEPF 208
gi 740742753 105 de-----aFDPNKVMQKPGFKILHVIDIDFRTHYYTLDACLKDIKLWSEAHPNHEPIFVTLEAKDGKAnm--fgTQPEEF 177
gi 503315429 104 se-----vYDKDGKMNTAGFKVFHIIDIDFRTSVYTLKDCMLALRKWSNEHPKHTTVFITLEPKDKDMsv--fgTKAEEF 176
gi 502457933 104 qa-----pFDEKGVMNEPGFKVLHVPDLDFRNDYLTLKNILAELKTWSDKHPDHYPIFITLEPKDGTSnek-ntTAPEPF 177
gi 495785566 104 qt-----pFDPQGQMLKPGFKVFHIVDLDFRSNCLTLKDGLQQLKAWSDAHPDHKPIFITIEPKDGVSksk-elTDPEPF 177
gi 503982839 106 qa-----pYDPNGEMLKPGYKVFHIVDYDFRTDSYTFAGILTRLKNWSKEHPDHNPVFITLEAKGGSEe-----SNTEKL 175
gi 283816863 104 qq-----pYDEAGVMNEPGFKVFHIQDIDFRSNSPTFKGCLAELKRWSDAHPAHYPVFITMNAKDDTIrra-gfTLPEPF 177
gi 505080467 110 agma-hlpFDEAGKLDQAGLKLFHVQDIDFRSHHLLFKDALNELSNWSYAHPDHHPIIILINAKDDSLpq---mTPPLPF 185
gi 495477879 105 sged-ipdYDPGDALSKPGLKLFHVQDLDFQSHYLLFANALKALKNWSENNPDHTPIYVLINAKDGNIpg---tRPVLPF 180
gi 503757559 107 mgse-pkpFDTEQKLKTPGLKVFHIQEIDFRSHQLLFKDALEELKAWSDANEGHLPIIVTINTKDSEIpq---tRNPLKF 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81792991  209 DRKAMDALDAELRSVFRPGEYVSPDTVRGTARTLNAAVLAHGWPALRATRGKVVFLLDQRAAG-ASYLPGHPSLRGRVCF 287
gi 740742753 178 TTSLFAELDNALKSGLGSDKLITPDKVKGKYETLEQAVLNNNWPTLKDARGKFLFILDDSGRKrDLYIKGHPSLNNRAMF 257
gi 503315429 177 TAELFEALDTEIITYLGRDKIITPDMVRGEYSTLEQAVLNHNWPSIENGKGKFLFILDDNDNKkKLYKNEHPNLKGRVAF 256
gi 502457933 178 TPKTYEELDKALIAGLGKEHIITPDMVRGKYKTLEDAVLHDNWPTLKDAKGKFAFLLDANGPKkDMYVAGHASLKGRVMF 257
gi 495785566 178 TAKTFDALDKEFKEYLGEQNIITPDVVRGKYTTLNDAVRHGKWPSLKSAKGKFLFLLDAKDHKrDLYIAGHPSLKGRMLF 257
gi 503982839 176 DVKAMDDLDAELVKYLGKENIITPDDVRGKYATLEEAVLKDNWPMLQAAKGKYLFVLDDHGDKrATYMEGHPSLKGRILF 255
gi 283816863 178 TASVLNQLDSVILAGLGRSKLIRPDDVRGNKPTLEAAVLAGNWPTLQASKGKFLFVLDETGTKrSAYIAGHPSLKNRVLF 257
gi 505080467 186 TAAALDSIDKEIRSVFAPEKLITPDLVRGDHASLEEAVLKEGWPALETVRGRFLFVLDEKQEKnNRYLSVHPNLEDAVLF 265
gi 495477879 181 TAAALDSIDLEIRTHLGMDHLITPDLVKGEFEDLESAVLAGNWPKLDDVRGKFLFVLDESEEKiDRYLSAKPELKDAVLF 260
gi 503757559 183 DAEALQNLNTEIAAVFSQERLVTPDLVRGNFDTLEEAVLQQGWPQLNKVQNRFLFVLDEGTEKiDAYLSRFPNLKGAALF 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81792991  288 TNAEPGQDDAAFTERNDGPAED--ITRLVQAGYLVRTRTDADLKEPARGDNRRRDAMLATGAQLLSTDFPAHEPAR-NGY 364
gi 740742753 258 ANANPGTPEAATLFRNNPEDKS--IKDLVSKGYIIRTRADAGTKEARSNDYSHFNMAKDSGAQIITTDYYLPSTLFkSDY 335
gi 503315429 257 VNDVEGSPEAGVMIINDPNTIL--IPKLVKKGYIVRTRADAGTKQARVNDYSNFEAAKKSGAQIITTDYYLPSTMFkSSY 334
gi 502457933 258 ANADPGQPEAAMLFRNTPTTPE--IKDLVAKGYIIRTRADADTREARLNDKSNFMAACNSGAQIITTDYYKKSTHFvSDY 335
gi 495785566 258 ANAEPGTPEAAMMIRNDPNDGT--IPVLVKQGYIIRTRSDADTQQARLNDYRDFEAAQKSGAQIITTDYYLKSTHFkSDY 335
gi 503982839 256 VNAEPGTPEAAVLIRNDSKEPG--IKELVQKGYIIRTRADGDTRQARVNDRSYFDAACNSGAQIITTDYYLKSTYFnSPY 333
gi 283816863 258 TNSEPATPEAAFLILNNSIEEQsqIQAMVKKGYLVRTRADSDTRQARSNDKRNFDAACQSGAQIITTDYYAKSQFFpSDY 337
gi 505080467 266 INVKEGHPAAGFRIINDPVQHHdyIQDLVSKGYMIRTRADAGTKEARNHDYTRFEKAKSSGAQVISTDYYIPSELFeSDF 345
gi 495477879 261 VNKKEGNPTAGFRIINNAVKDEayIRELVKKGYMVRTRADSDTKEARSNDYNTFEKAKASGAQVISTDYYLPSTFFkSDY 340
gi 503757559 263 VNQEEGNPTAAFRIINDPVENFdqIKNLVDLGYMVRTRADADTKEARENDYGRFEKAKASGAQVITTDYYLPSTFFkSDY 342
                        330
                 ....*....|....*
gi 81792991  365 VVRF-DGDAVARCAP 378
gi 740742753 336 HISF-ENGTYVRKNP 349
gi 503315429 335 QVKF-ADDVYERKNP 348
gi 502457933 336 EISF-DDKKYVRLNP 349
gi 495785566 336 VVSFaGANRYFRLNP 350
gi 503982839 334 QVYFeGQNKYIRLNP 348
gi 283816863 338 IISF-ANGTYLRPNP 351
gi 505080467 346 KVAF-DGNTYERSRP 359
gi 495477879 341 KVNF-EGNTFERPNP 354
gi 503757559 343 KVSF-ENNTYERTpe 356
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap