3M0A


Conserved Protein Domain Family
TRAF_BIRC3_bd

?
pfam16673: TRAF_BIRC3_bd 
Click on image for an interactive view with Cn3D
TNF receptor-associated factor BIRC3 binding domain
This domain is found in TNF receptor-associated factor 1 and 2 (TRAF1 and TRAF2), where it binds to Baculoviral IAP repeat-containing protein 3 (BIRC3) (cIAP2).
Statistics
?
PSSM-Id: 318808
View PSSM: pfam16673
Aligned: 11 rows
Threshold Bit Score: 92.0897
Threshold Setting Gi: 295321946
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
3M0A_A         2 ELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIG 64
gi 768958673 309 ELSRRCQDLELKVRTFENIVCVLNREVERSCTTMEAYNRQHRLDQDKIEILNNKVRQLERTVS 371
gi 260795017 314 ELRRKIAAWETRVGTFEGIVAVLNREIEKCSSQMEAYERQRRQDREIIETLERKVRSLERIIA 376
gi 556949704 328 vcEQKLTMLDNKVRVFENIVSVLNREVEKSNITVAAFERQSRLDQDTIASLEQKIADLQRSFA 390
gi 405966255 318 VIQAKVQALELKTGTFEGIVTTLHREIERCITAIENVERGRQGEKQVVDSLEKKIRALERSIS 380
gi 124295367 312 ELRRKIAAWETRVGTFEGIVAVLNREIEKCSSQMEAYERQRRQDREIIETLERKVRSLERIIA 374
gi 729745923 474 vreKVISELENKLHVFENIVAVLNKEVETSNLEITAFRRQSELDQNIIRGLELKIAELHrclt 536
gi 908499591 346 ELSRRCQELELKVSTFENIVCVLNREMERSCTTMEAYNRQHRLDQDKIEILNNKVRQLERTVS 408
gi 564339531 209 ELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIG 271
gi 704183012 116 ELLGRCEALERKTVTFENIVCVLNREVERVSLTAEAYSRQHRLDQEKIETLSNKVRQLERSIG 178
gi 847174610 237 EMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLG 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap