4I0O


Conserved Protein Domain Family
ELYS-bb

?
pfam16687: ELYS-bb 
Click on image for an interactive view with Cn3D
beta-propeller of ELYS nucleoporin
ELYS-bb is the N-terminal seven-bladed beta-propeller domain of ELYS nucleoporins in higher eukaryotes. It is required for anchorage of the nucleoporin to the nuclear envelope during cell-division.
Statistics
?
PSSM-Id: 318821
View PSSM: pfam16687
Aligned: 5 rows
Threshold Bit Score: 945.089
Threshold Setting Gi: 768935140
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A          5 QDLTAQVTSDLLHFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSLTGERLSAYRFSGVNEQPPVVL 84
gi 847131345    2 QNLEAQVTGGLVAFPDVTLKALKEDEINLDSVLRGRFSSGRTGLAWLACGPQLEVTNSVTGERLSAYHFSGLTERPPVIV 81
gi 514470116    2 RDLIAQVTSELLRFPQVTIQALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSVTGKRLSAYRFSGLNEHPPIVL 81
gi 971386803    2 QDLRAQVTSSLLQFPEVTIQALGEDEITLDSVLRGKFSGGRNGLAWLACGPQLEVVNSVTGERLSAYCFSGVSEQPPTVR 81
gi 768935140    2 RDLTAQVTSSLLPFPRVTIDALGEDEITLDSVLHGRFTVGRSGLAWLACGPHLEVVHALTGERLSAYCFSGGGENPPSVL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A         85 AVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAVVLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTD 164
gi 847131345   82 AVKEFTWQKKTGLLVGLVEAEGSVLCLYDIGISRVVKAVVLPGSVTAVEPIINHGGASASTQHLHQSLRWFFGVTAVVTD 161
gi 514470116   82 AVKEFSWQKRTGLLIGLEEAEGSVLCLYDLGISRVVKAVILPGRVTAIEPIISHGGASASTQHLHPSLRWLFGVAAVVTD 161
gi 971386803   82 VVKEFSWQKRTGLLVGLEEAEGSVLCLYDLGISRVVKAVVLPGRVTAIEPIINHGGASVSTQHLHQSLRWLFGVAAVVTD 161
gi 768935140   82 AVRDFSWLKRSGLLVSLEEVEGSVLCLYDLGLSRVVKAVVIPGRITAIEPLVSYGGASTSTQHLHQSLRWFFGIAAVVTD 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A        165 VGQILLIDLCLDDLSCSQNEVEASDLEVITGIPAEVPHIRERVXREGRHLCFQLVSPL--GVAISTLSYINRTNQLAVGF 242
gi 847131345  162 VGHVLLIDLCLDEVSSNQDELDASDLEVMSGIPVKIPKLREAAARERRHLCLQLAAPT--GTTVSCLSYISRTNQLAVGY 239
gi 514470116  162 IGQILLVDLCLDDLSCNQNEIEASNLEVVTGIPAEVPHIRESAMRAGRHLCFQLVSPS--GIAVSTLSYINRTNQLAVGF 239
gi 971386803  162 VGHVLLVDLCLDDLSCSQNEIEASDLEVVTGIPAEVPQRREAVTREGRHLCFQVQNPS--GTAISTLCYISRSNLLVVGF 239
gi 768935140  162 LGHVLLVDLCLDDLSCSQSELEASDLQVVTKSPGEIPRLREVSTRQGRHLCLQLNGPSggGVGVTALQYIPRTNQLAVGF 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A        243 SDGYLALWNXKSXKREYYTQLEGGRVPVHAVAFQEPENDPRNCCYLWAVQSTqDSEGDVlSLHLLQLAFGDRKCLASGQI 322
gi 847131345  240 SDGYFSLWNMKTLRRDYHVQIEGGKVPVCAVIFQEPENDPRNCCYLWAVQSS-DSGGDV-SLHLLQLAFSDRKCLASGQI 317
gi 514470116  240 SDGYLALWNMKSMKREYYTQLEGGRVPIYAVTFQEPENDPRNCCYLWAVQSTqDSEGDIlSLHLLQLAFGDRKCLASGQI 319
gi 971386803  240 SDGYLSLWNMKTLKREYHSQLEGGRIPVYAVTFQEPENDPRNCCYLWAVQSTqESEGDVlSLHLLQLAFGDRKRLASGQV 319
gi 768935140  242 SDGYLQLWNLKTLKKEYHSQLEGGRVPVYAFTFQEPENDPRNCCYLWAIQSAqELEGDMvSLHLLQLAFSERKCSASGKI 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A        323 LYEGLEYCEERYTLDLAGGTFPLRGQTSNTKLLGCQSIERFPSHGDREESXREAL-SPDTSVSVFTWQVNIYGQGKPSVY 401
gi 847131345  318 MYELLEYCEERYSLDLSGSTVSLRGQNSNTKLLGSQTIEKFRVHGEREDGVHEVT-SPDTSVSVFSWQMNTYGQGKPSVY 396
gi 514470116  320 LYEGLEYCEERYTLDLAGGMFPLRGPTSNTRLLGCQSIEKFRYHGDREEGMSE-AlSPDTSVSVFTWQVNIYGQGTPAIY 398
gi 971386803  320 MYEGFEYCDERYSLDLTGGAFPLRGQTSNTKLLSCQTVEKFRNHIDREDSVNEVI-SPDTSVSIFSWQVNTYGQGKPSTY 398
gi 768935140  322 LYEGLEYCEERYSQELSSSVFPLRAQATNTRLLSCQTIEKFRPHPDRDDSMNEVA-SPDTSVSVFSWQVKAYGQGTLSTY 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4I0O_A        402 LGLFDINRWYHAQXPDSLRSGESLHNCSYFALWSLDSVVSRTSPHhILDILVHERSLNRGVPPSYPPPEQFFNPSTFNFD 481
gi 847131345  397 LGVFDINRWYQAQMPDSLRPGQFLRNCSYFAFWSLEAVVNMTQDS-IFDILVHERSLSRGIPPSYPPPEQFYYPSTYNFD 475
gi 514470116  399 LGLFDINRWYHAQMPDSLRSGEYLHNCSYFALWSLESVVSRTSPHaVLDILVHERSLNRVIPPSYPPPEQFFNPSTFNFD 478
gi 971386803  399 LGVFDINRWYHAQMPDSLRPEEFLHNCPYFALWSLDAVTSVTSPNlILDVLVHERSLSRGVPPSYPPPEQFFNPSTYNFD 478
gi 768935140  401 IGVFDINRWYHAQMPDSLRTGESLQNCPYLAVWSLDSVVQMVSSHvLLDVVVHDRSLSRGLPFTCPPPEQYFNPTTYNFD 480
                         490
                  ....*....|
4I0O_A        482 ATCLLDSGVI 491
gi 847131345  476 ATCLLNSGLI 485
gi 514470116  479 ATCLLNSGIV 488
gi 971386803  479 GTCLLNSGVV 488
gi 768935140  481 ATCLLNSGMV 490
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap