Conserved Protein Domain Family
SNCAIP_SNCA_bd

?
pfam16700: SNCAIP_SNCA_bd 
Synphilin-1 alpha-Synuclein-binding domain
This coiled-coil domain found in Synphilin-1 is responsible for binding to alpha-Synuclein.
Statistics
?
PSSM-Id: 318831
View PSSM: pfam16700
Aligned: 3 rows
Threshold Bit Score: 88.1476
Threshold Setting Gi: 1043438969
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 597798587  493 VETCMSLASQVVKLTKQLHEQTTARIAIQNQVQLLFQSQDPNGRP 537
gi 961857162  532 VETCMSLASQVVKLTKQLNEQTAERINLQKHLQRLMDPSKAEGTP 576
gi 1043438969 500 VETCMSLASQVVKLTKQLKEQTAERINLQTHLQQLLEAHRTEGRS 544
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap