5F4V


Conserved Protein Domain Family
Izumo-Ig

?
pfam16706: Izumo-Ig 
Click on image for an interactive view with Cn3D
Izumo-like Immunoglobulin domain
Izumo-Ig is the immunoglobulin domain on Izumo proteins from higher eukaryotes. Izumo is a typical type I membrane glycoprotein with one immunoglobulin-like domain and a putative N-glycoside link motif - glycosylation site. The full-length protein is a molecule with a single immunoglobulin (Ig) domain. It is thought that Izumo proteins bind to putative Izumo receptors on the oocyte. Izumo is not detectable on the surface of fresh sperm but becomes exposed only after an exocytotic process, the acrosome reaction, has occurred. Studies have shown that knock-out mice (Izumo-/- males) were sterile despite normal mating behaviour and ejaculation, indicating the importance of the protein in fertilisation. There is a conserved GCL sequence motif. Izumo expression has been found to be testis-specific.
Statistics
?
PSSM-Id: 318835
View PSSM: pfam16706
Aligned: 18 rows
Threshold Bit Score: 126.308
Threshold Setting Gi: 47226643
Created: 8-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5F4V_A        149 VEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSV-NSSPATIINF 227
gi 81905793   170 IEVHRSEDLVLDCLLSWHRASKGLTDYSFYRVWENSSETLIAKGKEPYLTKSMVGPEDAGNYRCVLDTI-NQGHATVIRY 248
gi 1126256215 169 ITVHEMEDLRLNCELSWHRLSQGLASYNFFRVWGTKSETLLYTGNDHTLTKPAVTAEDAGVYRCSLDTV-SSGPATIIHY 247
gi 545487858  168 VVVHELEDLVLDCELSWHRISAGLNNYTFYRVLGSNS-LLLSVGKEPTLTKTMVRLEDAGTYRCELANM-KTSRAAVTHF 245
gi 565322778  161 VHVEIDEDLILDCALKWHKASHGVKTYRFYRMV-NNKEKLMASGADSFLTKKEVNMKDAGRYRCKMVDT-KGYTSSQLDF 238
gi 987958253  135 VNVHEMEDMILDCELNWHHISEGLTDYTFYRVWKNKSESMVYKGTAPTLTKARAKPSDAGTYRCQLNTV-KNSPATIIRY 213
gi 914922793  170 VEVHELEDLILDCLLTWHHISEGLTDYKFYRVWENNSETLLYKGKESTLKKPSVTEADEGKYRCELDTV-MSGPSTIISY 248
gi 612063732  126 VQVIEKGDLILDCELSWHKKAEGLTTYSFFKILTNGTEVLLSRGKDSALTKPMVAFEDGGSYRCILDTIrKHSPATIIVY 205
gi 1040135037 170 vEVHQMDDLILDCKLSWHQASQGLTDYSFYRVWGNNSETLMAKGKAHLLTKPLVGPEDAGTYRCELGTV-SSGPATIMRF 248
gi 587013492  170 INVHEKEDLVLDCELHWHKLSQGLTYYSFYRVWGSNSETLVYKGKQPTLTKPLVGPEDAGDYRCELGTV-RSLPATVIHF 248

                  ....*..
5F4V_A        228 HVTVLPK 234
gi 81905793   249 DVTVLPP 255
gi 1126256215 248 HVRVLPR 254
gi 545487858  246 RVRVLPQ 252
gi 565322778  239 QVVVLPP 245
gi 987958253  214 HVRVLPK 220
gi 914922793  249 HVTVLPP 255
gi 612063732  206 RVQVIPD 212
gi 1040135037 249 QVTVLPP 255
gi 587013492  249 KVTVLPQ 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap