2Y44


Conserved Protein Domain Family
GARP

?
pfam16731: GARP 
Click on image for an interactive view with Cn3D
Glutamic acid/alanine-rich protein of Trypanosoma
GARP, or glutamic acid/alanine-rich protein, is one of a subset of major surface molecules on Trypanosoma species. They are all surface-orientated, immunodominant, and highly charged. GARP is interesting as ts expression coincides with the loss and gain of variant surface glycoprotein (VSG) molecules in the tsetse vector. It has an extended helical bundle structure that is homologous to the core surface structure of VSG, suggesting that it might replace the bloodstream VSG as the trypanosomes differentiate inside the tsetse vector after a blood-meal.
Statistics
?
PSSM-Id: 318854
View PSSM: pfam16731
Aligned: 25 rows
Threshold Bit Score: 87.029
Threshold Setting Gi: 327200504
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Y44_A         3 EEVQTMCDVARQLRALETASQSAVAAVVSSAREASEAKERAEKAVERAK-S---KKRG---------VDTATEAAARAAA 69
gi 122123539  29 AQVLTLCQITEQLRGLKEVVMKIGPRAVEEALFTLKAKKRSEVSLRRAE-E---AAERdrna--gfaAERARLAYDSVCE 102
gi 74831174   28 EQTVTLCNALKQFRGLKDAVRDLKYWITTESLKISNAKTRSDEQLRRVK-E---PAQAttka--kalEKRARVLAANVTE 101
gi 74831174  240 QQTQALCIAAEQYRALPIFVSNIEEISKTMAQKAADAKIRSDNVVQLAE-E----ANEdgkg--kllSQRVRETVNEIAE 312
gi 343421049  28 EGVHALCKVLQQLKGVPSYIDNVEKTVRKDVESCEEAVAKSEASFQVVE-SiiaELENdtgl--eelFKSIEDERLKASG 104
gi 343470735 240 GQAKAFCKLTEQLRGLLDTVSRHNVTVTEEVAKTASSKNRSDEAVKQAE-S---AAGRnsda--aphAKRAKEAGEEVSA 313
gi 343470735  28 DQVNAFCELTKQFRHLPIAVGQQLDEAIDEEAKAAKARKDSQKAVNRAD-A---AAKKseda--kkhAQDAKEAAKEAFE 101
gi 343470735 452 KQVNAFCGLAEQFRGLLNSVKKLEGQATHCATVAAAVKARSTETVKRVV-A---AAGKnasa--kelAERAQAVEAEVTA 525
gi 342179875  38 lQTTAACGVAEQLRKLPAAVDAPLLEAERAAERAAKAWNESDRDAKRAE-K---AAAAagtaeaqgtAKRARDAAEDAYT 113
gi 74831840   33 EQTKALCEVAKQLRKLPLLTEERRFEAVGALEESKKAAKEGKKAAKRAEaG---AVGGtseq--qqaAKRAREAATVAYE 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Y44_A        70 AAQRAETVVSDARKHAADLTAASKDAIETTDESLRLLAT-XEaDEPIRTAAKKC-TGAAAEVTSKSLESAFDALAELLP- 146
gi 122123539 103 AVEFAEYAATSIEGRASSLLVIQEYYVPFLEDVMLRVGTdAEaAE-AQEAAMSC-LQTKRSVSPTSLSEAALELRVRLGv 180
gi 74831174  102 AVKKAEIVILESDVDAGVLGTISSAYVPSLEGALKKLGNeGGtVE-VKGVAKSC-NKTTKNVTVESLIHALDDMLQYFPa 179
gi 74831174  313 AAEAAEKAYRALTGHSVYMKSVAAAYAGSLEKTLLSISQyAAsQA-TRKAAEAC-RETAEVVTPKSLEDTKNGLFHSIPa 390
gi 343421049 105 AADDAVLGLRQFQRSENEVVHVITLYKNYVMKKIEGKKEyAN-DPKVREAAKDC-TETDYSVTVASLGEALKEFIDLSPs 182
gi 343470735 314 AADEAQKAHEDSSRVVQNLRLLAKDKLSSYDRFLKNVGE-RAsGKDAQNAAKEC-TDSAVDVKSEVVEKLNAAFEESTPg 391
gi 343470735 102 AADGAEVHLQAASELATELNGLVETHLSRLENILKD-AEtDGeDEHAREAAKEC-TGNATNVTSGTLLESKEKLEKAAGk 179
gi 343470735 526 AADKAQEAYAGVSGFVGNLTASRDEHLLVLEDVITGAKTsAScSCGIRAAKAC--TAAAEDVTAESLKEAKDTFRQDIPg 603
gi 342179875 114 ASVHAEGEKIKAQQEASKLKDFHEEYESPFNKLLEGTAEnGK-NSTIKDVAKNC--GVASDVTPDSLKATAAALNEQYSq 190
gi 74831840  108 ASVRAEAAAMEVKRFARALDSFESEYESVFSGLLRGAAEhGG-NETIKQLAKECaTAVADDVTPEALTRAAHNLRGLYMq 186
                        170       180       190
                 ....*....|....*....|....*....|....*...
2Y44_A       147 DGADDIREHGAVFVKGLKSLEDDVRTAGEAKYEAEKAE 184
gi 122123539 181 RNFRALRRDLHRAAFCLYSLKKTAAKIALARSSVEEie 218
gi 74831174  180 KSIKRLKEATRDASNKLHKLEGAAQSLVEIKINAEYte 217
gi 74831174  391 QSSKRLKKDTAKLIESLTILHREYKQLNAAMQYAQAAE 428
gi 343421049 183 DYDTAIEKDVNLTISHIEFLESIAKRISEDVNEAVTAA 220
gi 343470735 392 KPFQPVKDLFKKFSDNLKELEGAADVASKSRAKAEAAE 429
gi 343470735 180 EDYEELRYDTERAGSLLDDLKGAQLEVSSLQIKATNae 217
gi 343470735 604 DHYKELSDGAENVCGRLEELRSTAQRVsasraaaqaae 641
gi 342179875 191 EFMREYGQKATQAAESLTELQGAASEGKKAADDAEEAR 228
gi 74831840  187 DFAEEYLQEANEAANKLEELQKATAETVRAADAADDAK 224
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap