2L9S


Conserved Protein Domain Family
PHF12_MRG_bd

?
pfam16737: PHF12_MRG_bd 
Click on image for an interactive view with Cn3D
PHD finger protein 12 MRG binding domain
This domain found in PHD finger protein 12 binds to the MRG domain of Mortality factor 4-like protein 1.
Statistics
?
PSSM-Id: 318859
View PSSM: pfam16737
Aligned: 18 rows
Threshold Bit Score: 60.372
Threshold Setting Gi: 156392707
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....*
2L9S_A         11 RRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS 45
gi 357618139  170 LSPMEILVKAAKVMNPKQFELPREMKIPCNFPGTE 204
gi 568253681  238 NTPLDYLIRAAKILNPKQFELPSDYEVNFPFPGTE 272
gi 189238110  129 VSPMDLLIQAASSMNPKQFDLPRSMSVPCIFPGTD 163
gi 170058471  158 LSPLDQLIRAARILNPRQFELPREINSHFPFPGTE 192
gi 242013407  225 MTPMDLLIEAAIESNPKQYDLPKELTISMPFPGSE 259
gi 156544115  121 KNALEVLALAASLVNPKEFELPRELQIPITFPGTD 155
gi 196010575  108 RSPFAVLVKDNVKQNPSEFRLPKEMQYHIPLPGSK 142
gi 156392707  148 DSPFSTLVKMSTGKNPSTFQLPPELKCTTVFPGdr 182
gi 18858131   179 PTPLDDVIRAATMMNPQQFSLPPELELHTQFPG-N 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap