3ZH7


Conserved Protein Domain Family
Adhesin_E

?
pfam16747: Adhesin_E 
Click on image for an interactive view with Cn3D
Surface-adhesin protein E
Adhesin E plays a role in pathogenesis. It binds to host proteins including plasminogen, vitronectin and laminin.
Statistics
?
PSSM-Id: 318868
View PSSM: pfam16747
Aligned: 6 rows
Threshold Bit Score: 188.033
Threshold Setting Gi: 521290710
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZH7_A         2 VkLAPPTDVRSGYIRLVKNVNYYIDSESIWVDNQEPQIVHFDAVVNLDKGLYVYPE-PKRYARSVRQYKILNCANYHLTQ 80
gi 81637389   32 V-LTLPTLIESGFVRLEQNPNQFIDAQRVKKDPLNPNQVHFDVVENFEKAVYAYPEqPERYAKSLRQVYFVNCESHGLAL 110
gi 81387549   31 P-LLPPSLVQPGFVRMPHNLHYYADINSVWVDSDSKNMIHFDAVINLRKGPHVYSD-RDKIAKSMRQAKVVNCDTMKLTH 108
gi 501019697  27 vsLSPPEETAPGFLRMSPASYYYVDISSIVAEPEQKHIVHFDTVINLRKGNYIFTD-PAVFARSIRQSKVLNCRNYQLKQ 105
gi 521290710  27 qeeTPPKRVVK-FVTLSSGVS-YLDFRTISLYDGNPYLRRIDVIHNYTKGMPVKKN-PLMMIRSERQSLVVNCDTHQFTH 103
gi 261412588  38 VpITPPKDTKNGFLQLMPGIFYYVDMDSIWVDNQDKRLIHFDSVINLDKGLYVFKEyPALFAKSMRQYKILNCENFYFTH 117
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
3ZH7_A        81 VRTDFYDEFWGQGLRAAPKKQKKHTLSLTPDTTLYNAAQIICAN-YG 126
gi 81637389  111 VSATYHADFWGKGEASPTQIQHLSLAKHYMHSPHKILGQVICKGiYR 157
gi 81387549  109 LKTDYYSEFWGTGDPVTPEHQKMRTVDLRKGSSLYTLAQVLCINlYR 155
gi 501019697 106 LKSDYYSDFWGAGQHTPVKKQREYIVKLRPSSSLYTLSEVICVNvMR 152
gi 521290710 104 VHKIYFSEHFATGDKIARMNTPGQWQDYPPTSLIGLTAGLLCKlped 150
gi 261412588 118 VRSDFYADFWGDGIRTAPKRQSQHTITLQPQSSLYILGQVMCANmYR 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap