2W18


Conserved Protein Domain Family
PALB2_WD40

?
pfam16756: PALB2_WD40 
Click on image for an interactive view with Cn3D
Partner and localizer of BRCA2 WD40 domain
This domain is found at the C-terminus of partner and localizer of BRCA2 (PALB2). It is a seven-bladed WD40-type beta-propeller. It binds to the N-terminus of BRCA2.
Statistics
?
PSSM-Id: 318873
View PSSM: pfam16756
Aligned: 7 rows
Threshold Bit Score: 602.562
Threshold Setting Gi: 847164224
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2W18_A         18 DSINPGNLQLVSELKNPS-GSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDA-WQWEKLYTWHFAEVPVLQIVPV 95
gi 556985727 1045 SDTNEETLKLISTLKNHS-HSCGVDLCSVWWDIDGRRRLNIVIACENSVSLWESLQE-NQWENTHTWDFTEVPVIQIVSI 1122
gi 847164224 1062 S--EGGHLRLISQIQDGCfGKCMIDLCSVQWEFPSGTEMCIVGASESAISLWRPHSAgRQWEAAHSWIFTEMPVIQILPL 1139
gi 355756637  847 DSVNPGNLQLVSKLKNPS-GSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDA-WQWEKLYTWHFTEVPVLQIVPV 924
gi 431908505  872 DSVVPGDLQLVSRLKDPS-APCAVDVSALWWDVAGLKEPCIVTACEYAVSLWKPLDT-WQWEKIYSWHFTEVPVLQIVPV 949
gi 821468858  645 DTLELGNLQLVSKLKNPS-NSCSVDVSTVWWEVTGCKESCIITACEFTVSLWKSLDN-WQWRKVHTWHFTEIPVLQIIPL 722
gi 513208530  998 DGLREENLQFISKLKDSS-GSCAVDVSSVWWGAAGYRELCVVTACESSVSLWKPQAP-DHWEKVYTWQLGEIPVIQIIPV 1075
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2W18_A         96 PDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQF 175
gi 556985727 1123 PEAINLICVALGKLEIGEIRTLFYSREEGTFRQSLLRSGDMKIVLGLTDRRVVSCNSGYRKQNVELISLSEEGRNEGTLT 1202
gi 847164224 1140 PGEKNIMCVALGNLEILEIWALFSCPRGLSWEQRVVKLGHTETARGLSKLRLVCSSGLGPNQEVEILQLSEKGRTMRSHT 1219
gi 355756637  925 PDVYNLVCVALGNLEIREIRALLCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQF 1004
gi 431908505  950 PDVCDLVCVALGNLEIQEIRALLCPSDGESGKQVLLSSGHIQAVLGLTKRRLASSRGTLCDQQVEVMTFAEDGGSKEKRF 1029
gi 821468858  723 WDACNLVCVALGHLEIREIRLLFSSAEDECLKQSLVKSGNIKAVLGLRHKRLVCSNGTLHDHQVDLMTFSGSGRSKEKQT 802
gi 513208530 1076 PDTCNLVCIALGNLEIGEIRLLLYSSENDSFKQSLVKSGNIKAVLGLRDGKLISSSRAMQEQQVEIVSLSETGRCKDRQT 1155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2W18_A        176 LMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESL 255
gi 556985727 1203 LMSPGESILAFAEVDGEKDALIATTDLYNIVLWNIKTGQLLQSISIGNSYPTSLCLKAFSDSGLLFAILCNQHNNKSESS 1282
gi 847164224 1220 LQPPEASILSFSEVEGEADAVVGSTVDNKVVIWNGATGQLLSTINVGELCGDSACLSAYSDSGLLFLLLASPYSNSLEAA 1299
gi 355756637 1005 LMPPEETILTFAEVQGMQEALLGTTVMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESL 1084
gi 431908505 1030 LMPPEETILTFVEVQGMQDALLSTTVTNSIVIWNLKTGQLLKKMHIGDSYQASVCHKAYSEMGLLFVVLSHPCAKESEPS 1109
gi 821468858  803 LMSPEETILAFAEVQGMQDALLGTTLMSNIVIWNLKTGQLLKKMQIGNAYQASICHKAYSDMGLLFVVLSHPHGKEIESM 882
gi 513208530 1156 LMPPEETVLAFAEVEGVRDALVGTTAVNSVVVWNLKTGQLLKKMHIGYSYPASICHRAYSDSGLLFVVLSHPHAKESELC 1235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2W18_A        256 RSPVFQLIVINPKTTLSVGVMLYCLPPGQAGR--FLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVK 333
gi 556985727 1283 LDSVLKLVAINPKKGHNSQVLAYTLPAGFRGQ--YLDGDVSGQTVAAVLTSGAIVLWDLLYGHCTAQLAPETDESWSLVR 1360
gi 847164224 1300 RKCIFTLIAANPKSERCAHVMSYTLPEGQDGR--YLEGDIISHNAAAVLTSGSVAFWDLPRSHCSALLITNVDIHWSLVR 1377
gi 355756637 1085 QSPVFQLIVINPKTTLSVGVMLYCLPPGQAGR--FLEGDVKDQCAAAILTSGTIAIWDLLLGQCTALLPPISDQHWSFVK 1162
gi 431908505 1110 GSPVFQLIAINPKTTLNVGVMLYCLPRGQTGRqvFLEGDVRDSSAAAVLTSGTVAVWNLLLGHC-AVLPPVSGQSWSFVK 1188
gi 821468858  883 GNPIFRLIVINPKTALSVDVRPYSLPQGHTGR--FLDGDVKDNLAAAVLTSGTIAVWDLFLGHCRALLLPNSDGNWSFVK 960
gi 513208530 1236 GNPAFRVIAFNPKTARSTGVMFSSLPPGHTGR--YLEGEVKDAWAAAVLTSGAIAVWDLLLGCCTALLPPGSDSRWTLVR 1313
                         330       340
                  ....*....|....*....|.
2W18_A        334 WSGTDSHLLAGQKDGNIFVYH 354
gi 556985727 1361 WANLDSCLLAGQKDGHVLIYE 1381
gi 847164224 1378 WTHSMSQVLAGQKNGTIYIYS 1398
gi 355756637 1163 WSGTDSHLLAGQKDGNIFVYH 1183
gi 431908505 1189 WSGTHSHLLAGRKDGSIFVYL 1209
gi 821468858  961 WSGTDSCLLAGQKNGSVFVYS 981
gi 513208530 1314 WSAAGAGLLAGRADGSVCVYR 1334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap