Conserved Protein Domain Family
MCM3AP_GANP

?
pfam16769: MCM3AP_GANP 
MCM3AP domain of GANP
MCM3AP_GANP is the C-terminal domain of germinal centre-associated proteins, GANPs in higher eukaryotes. GANP forms part of the TREX-2 complex which in higher eukaryotes requires the MCM3AP domain of GANP to facilitate its localization to the Nuclear pore complex and nuclear envelope. TREX-2 complex links transcription with nuclear messenger RNA export.
Statistics
?
PSSM-Id: 318884
View PSSM: pfam16769
Aligned: 20 rows
Threshold Bit Score: 676.753
Threshold Setting Gi: 620983884
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1254 AFPAAPCCVDVNDRLQALVPSAECPITEENLAKGLLDLGHAGKVGVSCTRLRRLRNKTAHQIKVQHFHQQLLRNAAWAPL 1333
gi 449506397 1085 AFPAAPCGLDSKHQLKALSPSAEWPIGMENLCKRFVNLGNGGKLGISCTRLNFLRNKTVHEIKVQHFYQQLVSDLAWTPL 1164
gi 573898015 1450 AFPAAPCCVDPRFKLKALAPSAPSPPSLDLLARSVVNLGNAGNVAVSCTRLLQMRNAALHQMKVHYFYRQLLSESAWTPL 1529
gi 597796908 1385 GFPAAPCCVDPRFKLQALAPSAPPTPSVESLAQGYVNLGNSGNMVVSCTRLFKTRNDTFRQMRVNFFYNLLLSERVWRPL 1464
gi 765155915 1337 GFPAAPCCVDPCFKLKALAPSAPTQPSLADLARGMVNLGNAGSLTLSSTRLLEMRQEVTHQMRVHYYFQQLLEKHVWAPL 1416
gi 556983195 1455 VFPAAPAAHDLRCNLQALAPSAS--ITQESLAKGVVNLGHAGSLEVSCTRLLHMRQETIHKMKVQYFYEQLLCDAAWAPL 1532
gi 512867406 1633 GFPAAPGSVSRNDKLKALLPSAALHGAHLGFAKGFLNLGHAGKIGVSFTSFHQSREKIFHQMKVQHFFQKLLCDAAWTPL 1712
gi 620983884      --------------------------------------------------------------------------------
gi 733894242  857 AFPAAPCCMDLKNKLKALSPSAEWPITMENLCKRIVNMGNGGKLGVSCTRLNWLRNKTAHDIKVQHFYQQLLSDLAWTPL 936
gi 929514075 1113 AFPAAPCGLDSKHQLKALSPSAEWPIAMENLCKRFVNLGNGGKLGISCTRLNLLRNKTVHEIKVQHFYQQLVSDLAWTPL 1192
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1334 DLPSIVSEHLPMKQKRRFWKLVLVLPDVEEQTPESPGRILENWLKVKFTGDDSMVGDIG--DNAGDIQTLSVFNTLSSKG 1411
gi 449506397 1165 DLVSLITEHIPVQQEQVFWKVLLVLPSDDEYSKDDPNRILVDWLKAKFMGHRSDEKNAS--HTESKIQTLTLFSSPGMQG 1242
gi 573898015 1530 DLPSLVAESFPSPANRIYWKAALLLPSNEECEMSVTNSILTDWLKAKFGGRENSENMEQ--NQNDKIQTLSICNGLRNHG 1607
gi 597796908 1465 DLPTLVAESTPNPPNRIFWKATLLLPSNEDTDMSFANSTLTKWLEVKMGGGDEEEEDGSmaEVEGKLETLLISNNLRDVG 1544
gi 765155915 1417 DLVSLVTENIPIAHDRIFWKALLLLPSDQESAASMANRVLSDWLEAKLGGEQQSE---E--HLDGSLWTLCVTNALQESG 1491
gi 556983195 1533 DLPSLIAETFPSPSNRIFWKMILLLPSCEEPHTNETNRVLAEWLKAKFRGDGQLEDETT--DPEDKLQTLALYSSSRTRE 1610
gi 512867406 1713 QLPSLIAQNLESWKDCIFWKLVLLLPETSEIP--EPSSILSEWLKAKF--SWTGGQTSD--TEQQSVDTLVLYSSLESQN 1786
gi 620983884      --------------------------------------------------------------------------------
gi 733894242  937 DLASLIAEHIPIKQDQVFWKVLLVLPNDDEYEEDDPNRILIEWLKAKFLKDRSWKKTAS--CEEVRIQTLTLFNSSGVRG 1014
gi 929514075 1193 DLISLITEHIPVQQEQVFWKALLVLPNDNEYCKDDPNRILMDWLKAKFMGHKSCEKNAS--HTEGKIQTLTLFSSPGMQG 1270
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1412 DQTVSVNVCIKVAHGTLSDSALDAVETQKDLLGTSGLMLLL----PP----KVK---SEEVAEEELSWLSALLQLKQLLQ 1480
gi 449506397 1243 TRSIKVSVCIKVAHGLLSNSELDLAETQKDLLGTSGLVLLL----PP----RVS---SEDIAEDDVYWLSALLQLKQLLQ 1311
gi 573898015 1608 DKSQNVHICIKVTHGPLSLEGMSQMERQKDVLGTSALLLLL----PS----LPGygaTEEKEELDVYLLSALLQLKQIQQ 1679
gi 597796908 1545 QRTHKVHICVKVSRGPLTDEGQSQLEEQKELLGTSALLMMLpllpSA----DQS---ELRQGEEDVPLLAALLQLKQVQE 1617
gi 765155915 1492 RRTQKVHIAVKASRGPLTDNNLSRVERCSELQGTGALILLV----PAlpvfEPG---LQDQGVPDSL-LSALLQLKQLQQ 1563
gi 556983195 1611 GQPVNVHVCIKVACGPLSEDRLDQTESQKDLLGTSGLVMLL----LV----GAG---GGDVEQEDVYWLSALLQLKQLLQ 1679
gi 512867406 1787 GRPVRVNVCVKVAQGPLTTSEMEQVETKRDLLGTSGLILLL----PP----------VDDSIEDDVYWLSALLQLKQLLQ 1852
gi 620983884      --------------------------------------------------------------------------------
gi 733894242 1015 SRNIKVSVCIKVVHGVLSDSELDASSTQKDLLGTSGLILLL----PP----QVR---SEDVAEEDVYWLSALLQLKQLLQ 1083
gi 929514075 1271 SRSIKVSVCVKVAHGALSDSELDMAETQKDLLGTSGLVLLL----PP----RVR---SDDIAEDDVYWLSALLQLKQLLQ 1339
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1481 AKPFQPALPLVVLVPSSRGDSAGRA-VEDGLMLQDLVSAKLISDYIVVEIPDSVNDLQGTVKVSGAVQWLISRCPQALDL 1559
gi 449506397 1312 AKPFHPIVPLVVLVPSQKEKAVEKE-VEDGLMLQDLISAHLISDYTIVELPGSVNDLEGTRRVSAAVGWLVSHCPASLEL 1390
gi 573898015 1680 VYSWQSALPLVVVVPKHAEQPTCEEkLEEGLMLQALVEENLISEYIFVHVPHSTNDLQGSEQIHQAVKWLVSRSPAAPDL 1759
gi 597796908 1618 ASGWNSPLPLALIIPGQPEGAISDEkLEEVLQLKTLVNDGIISEYVFIRVAGSVSDIQGSQQIGEAVRWLVAHSPASTVL 1697
gi 765155915 1564 VNTWHCPLPLVILVPGPDGGASYTNkLEKALRLHTLMTEGLISEFTFVFIPETSNDLQGSKQLSQALSWLLARATPPLSL 1643
gi 556983195 1680 AKPFRPAVPLLILFSPQGEEAVSKDqVEEGLMLQDLVAAKLISEYHIVEMPGLMTDLHGANRVSQSVKWLVSHCPSSVAL 1759
gi 512867406 1853 AKPFQPPIPLGVLVPAFGMNTMTK--VEEGLNLADLVSNGLISEYEIFPLSGSLDDLQGTEQVTSAVQFLLSSCPHTLEL 1930
gi 620983884    1 ------------------------mgdavGLLLQDLISSELISDYIIVKISSFLNDLEANLQVSKAVKWLASHSPRHPKL 56
gi 733894242 1084 AKPFQPTVPLLVLVPSLEEEATEKE-VEEGLMLQDLISAQLISDYIIVELPGSINDLEGTRRISAAMSWLVSQCPNSLEL 1162
gi 929514075 1340 AKPFRPIVPLVVLVPGQEEDAMEKE-VEDGLMLQDLISAQLISDYTIVELPGSVNDLEGTRRVSAAVGWLVSQCPASLEL 1418
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1560 CCQTLVQYVEDGISREFSRRFFHDRRERRLASLPSQEPSTIIELFNSVLQFLASVVSSEQLCDISWPVMEFAEVGGSQLL 1639
gi 449506397 1391 CSQTLQEYIEDGIDGEFGKRFYHDWKERRLAGLPSQEPGVIIELYNSVLQFLSDVASSEHFYDLSWPVTEFSEAGGNKML 1470
gi 573898015 1760 SSQTLVQFVEDGLCREFSTRFYHDKTERQASGLPCQEPAPIIELYNSVLRFLAGLVSSEQFSRLSWPVAEFSVPRPQNLL 1839
gi 597796908 1698 SSQPLVQFVESGLCREFHTRFHRDKQERMQAGLMCQDSTAIIQLYNSVLCYLADLVSCEQMIGISWPPPEFSLPENRDLV 1777
gi 765155915 1644 SCQTLMQLIETSLGRELDPRVFAIRQERATAHLLPQEPAPIIRLYNAILDHVADTVASQHLCRLSWPPGEFSLPHTRSFV 1723
gi 556983195 1760 CSRTLLQYLEDGLCNEFNDRFYTDKIERQVAGLPSQDPHAVIELYNSVLDFLAEVASSEELCDLSWPISEFVGPGSSETF 1839
gi 512867406 1931 CSLPLRQFIEDGICSGFSEPFHRDMWERKKARLPSQDPAAIIDLYNSVLAFLANVISSEQLSDISWPVTEFSCPNGTAVL 2010
gi 620983884   57 CCQTLSQFVEDGVHREFSRRFFWDRKERRLAGLASQKPGPIIDLYNSVLQFLADVISSEWLSNLSWPVPEFAEPEGTGQL 136
gi 733894242 1163 CSQTLQEYIEDGIDGEFGKRFYHDWKERRLAGLPSQEPGVIIELYNNVLQFLSEVASSEHLCDLSWPVTEFSEPGGNKLL 1242
gi 929514075 1419 CSQTLQEYIEDGIDGEFGKRFYHDWKERRLAGLPSQEPGVIIELYNSVLQFLSDVASSEHLCDLSWPITEFSEAGGNRVL 1498
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1640 PHLHWNSPEHLAWLKQAVLGFQLPQMDLPPPGAPWLPVCSMVIQYTSQIPSSSQTQPVLQSQVENLLCRTYQKWKNKSLS 1719
gi 449506397 1471 PHLQWNMPDHLAWLRKAVLSFQIPYLDLPPLGAPWHPVCHMIFQYVSQIASSSHTQPLIQSQVENLLSKTYQNWKTRTTG 1550
gi 573898015 1840 PHLEWNSPEHLAWLNRAILTLQIPDWDLPAQHASWPGLCARIFQFVAQIPFSRHSHPLLVSKVGHLLKRVHSEWMRGAMS 1919
gi 597796908 1778 PHLDWNSPQHLAWLKRTVLSLQIPEWDQPPINASWPHLCTSIFHYVSQIPSSPQSQPLLMSRLEHLLARVRAQHMQDGRE 1857
gi 765155915 1724 PHLAWNSVEHLAWLRKAILSLQLPEWEPLPPTDSWSELCSFIFHYAAKIPASHLSQPLLKSRLENLLERVRVKTHLTQTC 1803
gi 556983195 1840 PHLQWNTAEHLAWLRKAVLSFKLPEMDRLIVQAPWNAACRSISQYVSQIATSLHTQTMLISQVECLLNRVYTRWMDSEAA 1919
gi 512867406 2011 PHTSWNHPGHLAWLKKSVLSFQIPQMDKPPQGAPWLPVCSMILEYIDQICRCKQGLPVLLSEVQILLRHAYDKLHTNAGG 2090
gi 620983884  137 PHLYWNTPRHLAWLKEAVLSFQIPQIDIPP-SAPWNFICTTIFQYISQIPSSHQTQPVLQVQVENLLSGIYFKLKDKELA 215
gi 733894242 1243 PHMDWNVPDHLAWLKKAVLSFQIPYLDLPPLGAPWRPVCRMIFQYASQIASSSHTQPLIQSQVENLLSRTYQKWKNGPLG 1322
gi 929514075 1499 PHLQWNMPDHLAWLKKAVLSFQIPYLDLPPLGAPWRPVCHMIFQYVSEIASSSHTQPLIQSQVENLLSKTYQNWKTRTTG 1578
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1720 --------P--GQE----LGPSVAEIPWDDIITLCINHKLRDWTPPRLPVTLEALSEDGQICVYFFKNLLRKYHVPLSWE 1785
gi 449506397 1551 --------N--SDE----DGPSVDEIPWDCILAVCIDHKLRDWKPPKLPVAPEAISKDGQIRVYFFKGHLENYSVPFSWD 1616
gi 573898015 1920 --------AqeEEE----AGPAFQQVPWDEIVALCIDHRLKDWKPPESPVTEDAITDDGEILVYFVKEDLKKYEPPSSWL 1987
gi 597796908 1858 --------D--EEDtdekAGPSFSRIPWDDILFLCIDHRMKDWSLPESPVTEDAFTDSGEILVYYIKKQVMDFMPPESWV 1927
gi 765155915 1804 gfrgnmeyN--SRA----QSQSISQIPWDDVVMICIDHKLKDWQRPEESVCEDALTAGGDILVYFSAESLKDFRAPEDWT 1877
gi 556983195 1920 --------A--WGD----NGPSAQEIPWDDLLTLCINHRLRDWKPPGSPLESG--------------THLWA-GCPDQSQ 1970
gi 512867406 2091 --------R--YSE----EFPA-EEFPWDDLLNLCINHKLRDWDP---SVNSEYSGSLEDIHVYFLQDDLRNLSPSNLWE 2152
gi 620983884  216 --------S--SGE----GGFSVKDIPWDAIISLCINHRLKDWMPLTLPTVSEALSRDGEIRVYFSKDHLSEFTRPSSWE 281
gi 733894242 1323 --------N--TG-----DGPSVDEIPWDDILATCIDHKLRDWKPPKLPVAPEAVSEDGQIRVYYFKEHLKNFTLPFSWE 1387
gi 929514075 1579 --------N--SDE----DGPSVNEIPWDCILAVCVDHKLRDWKPPKLPVSPEAVSKDGQIRVYFFKGHLKNYTVPFSWD 1644
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1786 QAR-----MQTQR--------ELQ-LSHG--R------SGMRs--IH-PPTSTF-PTPL----------LHVHQ--KGK- 1826
gi 449506397 1617 QAR-----LRTQE--------EIR-QGHE--R------SKIKy--PK-SYKKPY-SFSM----------VPGQY--DSG- 1657
gi 573898015 1988 WAV-----RKTHK--------DKQqESFGfkL------SPARv--ST-PRLLHS-RQRL----------FDSPV--EKP- 2031
gi 597796908 1928 TAV-----KLTHK--------QKQkNLNGskE------SSVVa--SS-PSAHFP-RQRL----------FQSRI--EPE- 1971
gi 765155915 1878 EAV-----RKTHE--------EKKqEKNW--M------STADf--AT-SDTFSL-GQKL----------FHSPL--DAD- 1919
gi 556983195 1971 QKQpsrlaLRSHVacrsvmdfTKAlETRS--P------SVVDs--AHtPSAQNLsPQCLddtfekgeeeSHRLQ--KKPs 2038
gi 512867406 2153 RAR-----MSTHT--------DAQeTYDG--R------S--------------Y-RQRL----------PTQKT--KML- 2183
gi 620983884  282 RAR-----LRTQR--------EIQ-QSYE--R------SVSDs--NQ-SSKPND-GLGM----------TVERN--DGR- 322
gi 733894242 1388 QAR-----LRTQE--------EIR-QGHK--RsrvkspVSFKkpcRV-SMSDQY--GAG----------VSILS--Gqrr 1436
gi 929514075 1645 QAR-----LRTQE--------EIR-QGHE--R------LKLKs--PK-SFKTPY---SI----------APGQYgsDMS- 1685
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1827 -------------KKEESGREG-SLSTEDLLRGASAEELLAQSLSSSLLEEKEENKRFEDQLQQWLSQDSQAFTESTRLP 1892
gi 449506397 1658 -------------MLPR--QEVsVPSTDEFRDTSLAQE----HLLAQLQLEKIENKRFEEQLHQYLAEDMEPLEDLLGLP 1718
gi 573898015 2032 -------------GHATV---------ADITHTPSSRELLPHRLLSSLEAERAQSQRFEEQLQQWLEVDP---LDSFSMP 2086
gi 597796908 1972 -------------ESPT---------ALDITHSLSPQELLPHRLLASIQQEKAQSQRFEEQLQRWLEVDP---LDSVSMP 2026
gi 765155915 1920 -------------EASVTP--------LDVTHVPTTQERQAHKFLQSLEEEKAESKRSIEKLQRWLNGEP---LEHLSTP 1975
gi 556983195 2039 ystpeslvarrslTAIKKSLEMeLSSIADITHTLSAEELLPQRLQDSIEKEKKESEKFEEQLQQWLSEDP--LKQSFPFP 2116
gi 512867406 2184 -------------ASIRVSPEQnL-ENEELGAEFKHINKLRLQLKQSLEAEREESKGCKEKLQKFLEEEALETSASPLLP 2249
gi 620983884  323 -------------GRVTPgkkkeylpvEASDPSFSREELLSAHLSTCLQQEREESKKFEDQIQQWLTEDPgqlK--VSLP 387
gi 733894242 1437 n----------------------vssaDELR--ASAQD-LPERLLTQLKLEKVESRRFEEQLHQYLAEDIeplGDLMGFP 1491
gi 929514075 1686 -------------MLPAqevs--ipstDEFRDTSLAQE----CLLAQLQLEKIENKRFEEQLHRYLAEDMeplGDILGLP 1746
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940944 1893 -------LYLP-QTL-VSFPDSI-K------TQT------MVKTSTSPQN--SGTGkql-rfSE---------------- 1931
gi 449506397 1719 -------LYLP-QSL-LSTPAAT-C------P-L------VKSPMSAAQE--AGSQekhkipEM---------------- 1757
gi 573898015 2087 -------LFMP-STL-ISVPEIM-AasqrafPAS------AAVSLSMEAG--VPGEkwdrsgQR---------------- 2132
gi 597796908 2027 -------LFMP-STL-LCVPEIL-T------PSRrpaasaACFKKDTESD--DFAEkvpsscRR---------------- 2072
gi 765155915 1976 -------LFIPsSTL-LSMPLTIkQ------LSS------DETGVSPLSQ--GADEeperaeLK---------------- 2017
gi 556983195 2117 -------VYLP-QSL-VSIPEAI-Pv-----PFR------TSPSADLQGK--NRSKlelsdqAS---------------- 2157
gi 512867406 2250 -------MYLP-EAL-L-RPQEK-P------TNR------SHSGVHSSPL--HMSLetalyiSSpqrpvehnmsssplqr 2304
gi 620983884  388 qqftpvnLLQP-VALgVNTPALI-E----------------------LQV--SRQMent-rsMQ---------------- 424
gi 733894242 1492 -------LYLP-QSL-ISTPTLA-G------P-L------IKSPMSSVQV--DGSEarfelsID---------------- 1530
gi 929514075 1747 -------LYLP-QSL-LSTPAAA-C------P-L------VKGPTTAAQEagIQEGhkv-peL----------------- 1785
                         810       820       830       840       850       860
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 341940944 1932 ---ASG----------------------------SSLTEKLKLLERLIQSSRAEEAASELHLSALLE 1967
gi 449506397 1758 ---EQS----------------------------SALSDRLKHLQQLLRATKEAEAASELHLSALVD 1793
gi 573898015 2133 ---GCP----------------------------VSMEQRLQDLDRQIRASKEEELACELQLSSLLD 2168
gi 597796908 2073 ---DTP----------------------------VSLTQRLEELDRLIKANREEELACSLKLKGLLE 2108
gi 765155915 2018 ---KTT----------------------------TSISWKLQDLERQISLGHEEEVACSLKLSGLRs 2053
gi 556983195 2158 ---ETT----------------------------VPISDQLKKLDRLIKTNKEEDLACELHLSALLD 2193
gi 512867406 2305 apiKTPqlrsteniihaasqdsslseslsasplrPSLTDKLNELRRLINANRQENSALELHLNTLLD 2371
gi 620983884  425 ---EPS----------------------------TSLSKRLRHLENLIRATREEDRVFDLQLSTLRD 460
gi 733894242 1531 ---DRS----------------------------PALSDRLKHLQRLLRADREGEVASELHLSALMD 1566
gi 929514075 1786 ---EQS----------------------------PALSDRLKHLQQLLRATKEAEAASELHLSALVD 1821
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap