3K6G


Conserved Protein Domain Family
TERF2_RBM

?
pfam16772: TERF2_RBM 
Click on image for an interactive view with Cn3D
Telomeric repeat-binding factor 2 Rap1-binding motif
This domain, found in telomeric repeat-binding factor 2, binds to the C-terminus of repressor activator protein 1 (RAP1) (telomeric repeat-binding factor 2-interacting protein 1).
Statistics
?
PSSM-Id: 318887
View PSSM: pfam16772
Aligned: 10 rows
Threshold Bit Score: 63.947
Threshold Setting Gi: 308387806
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
3K6G_D         2 LRNPPTTIGXXTLKAAFKTLSGAQDSEAAFAKLDQKDLVLP 42
gi 345307377 211 LPESPATFGISALKGAFKTLSTFQDPDAAFTKLDQKDILIP 251
gi 483505101 318 PPGTVTTYGISVLREAFKILSDSPDADALFTKLDETDFSLP 358
gi 221139718 251 EADCVISYGLSVLKSKFMSLCQEEDTDTMFRKLCETDF-CR 290
gi 823466854 353 PPGAVTSCGISVLREAFKILSDSGDPDTLFTKLDETDLPCP 393
gi 733906784 492 PLRTVTTYGISVLREAFKMLSNSPDSDALFNKLDETDLPSP 532
gi 987939110 199 LRNTPTTFGIMTLKAAFKTLCGSQDSEAIFSKLDQKDLVLP 239
gi 537204650  95 PRNTPTTIGIRTLKAAFKALSTAQDSEAAFAKLDQKDLVLP 135
gi 821462566 313 LPEGPSTFGISTLKRAFKSLSDSQDPEAAFTKLDQKDVTVP 353
gi 637361411 356 PLERPTSYGFSVIRQAFEILSDSEDPDATFQKLDETDWTFP 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap