2WZP


Conserved Protein Domain Family
Caudo_bapla16

?
pfam16792: Caudo_bapla16 
Click on image for an interactive view with Cn3D
Phage tail base-plate attachment protein of Caudovirales ORF16
Caudo_bapla16 is a family of ORF16 tail-phage P2-like proteins that forms part of the base-plate at the tip of the phage tail. The whole base-plate complex is involved in host recognition and attachment, and consists of several proteins derived from consecutive open-reading-frames. This central domain is expressed from ORF16 in the lactococcal P2-phage and forms a trimer.
Statistics
?
PSSM-Id: 318901
View PSSM: pfam16792
Aligned: 9 rows
Threshold Bit Score: 686.84
Threshold Setting Gi: 526241750
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WZP_R         1 MLEANVYDNFNPNYYNISDFSMPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 75078017    1 MLEANIYDNFNPNYYNISDFNLPNGKKEKRGLPIPRARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 471216348   1 MLEANVYDNFNPNYYNISDFNLPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 9630584     1 MLEANIYDNFNPNYYNISDFNLPNGKKEKRGLPIPRARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 115304228   1 MLEANVYDNFNPNYYNISDFRLPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 526244484   1 MLEANIYDNFNPNYYNISDFNLPNGKKDKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 981678098   1 MLEANVYDNFNPNYYNISDFSMPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 471216226   1 MLEANVYDNFNPNYYNISDFNLPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
gi 526241750   1 MLEANVYDNFNPNYYNISDFNLPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WZP_R        81 EALGKKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPNKNNLMSYGYFFNSSIFAGK 160
gi 75078017   81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSTIFAGK 160
gi 471216348  81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSSIFAGK 160
gi 9630584    81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSTIFAGK 160
gi 115304228  81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSSIFAGK 160
gi 526244484  81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSSIFAGK 160
gi 981678098  81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSSIFAGK 160
gi 471216226  81 EALGQKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSTIFEGK 160
gi 526241750  81 EALGQKKKLNLDIVYLVTSVDESNKATLKNYFRAMIESLDVPNAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSTIFEGK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WZP_R       161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHAPSETDPRNLLFINFASRNWNRKRITTRVDIKQSVTMDTETIVERSA 240
gi 75078017  161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSEADPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 471216348 161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 9630584   161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSEADPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 115304228 161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQSVIMDTETITERSA 240
gi 526244484 161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 981678098 161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 471216226 161 ATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQSVTMDTETITERSA 240
gi 526241750 161 ATINRKAETSSANDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFASRSWNRNRITTRVDIKQNVTMDTEIITERSA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WZP_R       241 YNFAVVFVKNKATDDYTDPPKMYIAKNNGDVIDYSTYHGDGTDLPDVRTAKTLFYDRDDHGNPPELSTIKVEISPSTIVT 320
gi 75078017  241 YNFAVVFVKNKATDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPEVRTAKTLFYDRDEHGNPPDISTIKAEVSPSTIVT 320
gi 471216348 241 YNFAVVFVKNKATDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPEVRTAKTLFYDRDEHGNPPDISTIKAEVSPSTIVT 320
gi 9630584   241 YNFAVVFVKNKATDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPEVRTAKTLFYDRDEHGNPPDISTIKAEVSPSTIVT 320
gi 115304228 241 YNFAVVFVKNKETDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPEVRTAKTLFYDRDEHGNPPDISTIKAEVSPSTIVT 320
gi 526244484 241 YNFAVVFVKNKATDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPDVRTAKTLFYDRDEHGNPPDISTIKAEVSPSTIVT 320
gi 981678098 241 YNFAVVFVKNKATDDYTDHPKMYTAKNNGDVIDYSTYGGDGTDLPDVRTAKTLFYDRDDHGNPPDISTIKAEISPSTIVT 320
gi 471216226 241 YNFAVVFVKNKETDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPDVRTAKTLFYDRDDHGTPPDISTIKAEVSPSTIVT 320
gi 526241750 241 YNFAVVFVKNKATDDYTDPPKMYTAKNNGDVIDYSTYGGDGTDLPEVRAAKTLFYDRDEHGNPPDISTIKAEISPSTIVT 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|..
2WZP_R       321 RLIFNQNELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 75078017  321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 471216348 321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 9630584   321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 115304228 321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 526244484 321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 981678098 321 RLIFNQSELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 471216226 321 RLIFNQNELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
gi 526241750 321 RLIFNQNELLPLYVNDLVDIWYDGKLYSGYIADRVKTEFNDRLIFVESGDKP 372
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap