4DI3


Conserved Protein Domain Family
TAtT

?
pfam16811: TAtT 
Click on image for an interactive view with Cn3D
TRAP transporter T-component
TAtT is a family of one component, the T-component, of a sub-set of TRAP-Ts or Tripartite ATP-independent periplasmic transporters. TRAP-Ts are bacterial transport systems implicated in the import of small molecules into the cytoplasm in bacteria. They are all periplasmic lipoproteins. TatT consists of a 13-alpha-helical fold containing cryptic tetratricopeptide repeat motifs (cTPRs) and encompassing a pore, ie is a water-soluble trimer whose protomers are each perforated by a pore. It forms a complex with a P component, and a putative ligand-binding cleft of TatPT aligns with the pore of TatT. Family TatPT is represented by some members of pfam03480.
Statistics
?
PSSM-Id: 318915
View PSSM: pfam16811
Aligned: 17 rows
Threshold Bit Score: 269.564
Threshold Setting Gi: 588291723
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DI3_C        37 EEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQT----------------Paqylpede-feaq 99
gi 123733080  41 SETDLELLRDAAPFHLKLSESILRQDPGHLGLAESVAAGFTQYAYAFVAF----------------Egeqieakd-akaa 103
gi 122368500  39 NNNDLQLVEDGLPTYLLMVDGLIENWPKSESLLSSGADLYGAYAGLFVKE----------------P------------- 89
gi 123745563  45 RETDIELARASLPAQLKMIEALLLADPGNGAYRVQAAMGFHGYALGFVEA----------------Dd------------ 96
gi 500018800  37 TDDDPDLVGQALPFGLKTIEGLLAESPRHKGLLLAAASGFTQYAYAFVQTeadfaedadlaraialR------------- 103
gi 753991926  35 REPDLELAKAAIPANLKLVESLTRELPANRELRIHAAQGFYGYTFGFVEDd--------------nP------------- 87
gi 493984952  42 EEDDLELARQAMAANLKLVEGLLKSDAQNQTLLQILAQGYAGYALAFVEDt--------------nA------------- 94
gi 505216570  39 QQTDIELVCEGTPAILLMIDSMVASDPENKDLLMTATKAFSGYAAALDACn--------------kP------------- 91
gi 502793979  41 NQNDPETVEAGMPSYLLLADSMIEGDPQNEHMLLSGSKLYGAYAAAFVREperarr------------------------ 96
gi 752808728  41 TDDDPELVRGAVPFGLKTMEGLLSEDPHHEGLLRALAGNFTQYAYAFVQA----------------Dadladlqgnldaa 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DI3_C       100 neaySRARKLYLRGARYALSSLETAYPGfT-REVFSGDEQRLHKvlsrCTRVDVGTLYWVGTGYVAAFALTPLGSALPDT 178
gi 123733080 104 erlrQRAAKLYERAHRHAMRGLETAAAGfT-GALVSTQEKDWPA----IRPEQVGLAYWAAASWGGWISLSKDNPDVVAD 178
gi 122368500  90 ----ERARKLSIKALDYGFRAACAHDKD-Y-CDLRSLSVPEFEAlledANKGDVPVLFSLGGAWAGYIQQNTNDWNAVAE 163
gi 123745563  97 ---pARALALYERAREHAFLALETD-AGlT-RAALLGDLTGLDAalarLDTEAAPALFWAASAWAKWIELQLDEPARLDE 171
gi 500018800 104 ----QRAGRLYRRALGYGLRGLEEVHPG-FlQALRADP----DAalagFRKADVPQLYWTAAAWGSAIALDKTDTELGAD 174
gi 753991926  88 ----VRASALYRRGLEHALAALETAGLG----DPMNMQLDVLHQklatLGRDAVPDLFWAASNWAKWIDMNRTDPARIAD 159
gi 493984952  95 ----NRARKLYLRARDYAWRLLEAQNKQ-LaKTLKTASAADWERillkARKKNVPALFWLGFSWSSYINLSLEDPQAILD 169
gi 505216570  92 ----HRAAMVSVKARRYGLSLLWPNSDl---HILATLPLPDLQKrlagLSDSDVDSLFWAGNGWGTWILHQQGTPASLAQ 164
gi 502793979  97 ---------larkarDYSDRALC-AHDV-QlCKLYEQPYDKFAAavanLKADDVPLLYGSATAWAGWIQANSSDWNAIAT 165
gi 752808728 105 ragrERARKLYLRARDYGLRALEQRHDGlS-KRLREGR--DVAGalkaAEKKDVEVLYWTASAWTLAIANGKGDMGLVAE 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DI3_C       179 VHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPesfGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAG 258
gi 123733080 179 LPLAVRLAQRAWAVDPDWGQGTLTGLLGTFEAARP---GGNQQQALVYFDRAIEQSAGKSAGALLAKAEGHAQPAGDREQ 255
gi 122368500 164 LGRVEAIMERIVALDEHYQYGQAHMYLGVLNSILPaslGGNPELAKTHFEQAVQLADGKNLLAQVLYAEKYARLLFDREL 243
gi 123745563 172 LPRVEHMMRRVLQLDETYYHGGAHVFFGVYYGGRApmfGGDFARAETHFARARALAPGFQW-VDVYRARYLLRQRGEREA 250
gi 500018800 175 LPLVEALMRRALKLDEGFGRGAIRDFFIVYEGGRPasaGGSIERAREHFSRSLVLSGGRRAAPLVSFAETVDVGLQDRAD 254
gi 753991926 160 MGKAEALMQRVLELDETFYFGGPHIFFGVWYGSRPpmlGGNFALSEMHFGKARNITQGKLLIADVLYAQYLAVQQGNRKA 239
gi 493984952 170 LARVEPVMKRVLELDSSYFYGATYLFFGSLYGQKPpllGGNPQKARAFFEKNFKLTGGKFLLSYVYAARFYAAKTLNEQL 249
gi 505216570 165 LIRVEQIMLRVLELDERYYYGAAHLFLGAYYGSKPpllGGDFEKSRHHFERALGFSNREYLPGLVLYAETYARMSFDREL 244
gi 502793979 166 LPKVKAMMERVVTLDETYSHGEAHLYLGVFATLLPpalGGKPEEGRVHFERAIQLSAGRDLMAKVEYARRYARITYDREL 245
gi 752808728 182 LPVPVAMMERALALDEKWGQGALHEYFVSLDAARGeveGGGPARAKAHLERALELSMNKKLGPRVAYAEGVLVKQQDRAA 261
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
4DI3_C       259 FDEALDRALAIDPESVpHNKLLVILSQKRARWLKAHVQDFF 299
gi 123733080 256 FESLLKQALAIKDEAGsPQALQNEVMRRRARWLLEKADDLF 296
gi 122368500 244 HDSLLNEVLAADPDVH-GLTLQNTYAQQQAEALLADADDYF 283
gi 123745563 251 FHAALTAVRAAAAAADpELNLANALARKQAEALLAQEEELF 291
gi 500018800 255 FERLLHQALAIDANAEpEERLANVIAQRRARWLLSRMDRLF 295
gi 753991926 240 FHDKLTAVVDTPPDNFsEMALANAIAQHKAKNLLKNEEELF 280
gi 493984952 250 FDSYLQKVLDSPIDIQpNVRLLNQVAKQKAKRLLKKKSEMF 290
gi 505216570 245 FSSLLQEVLDFPLESRpDLGLANQLAKLKARELLGGVEEYF 285
gi 502793979 246 HDRLLHEVLDADA-TEpGLTLSNVLAQRQAKALLASADSYF 285
gi 752808728 262 FERELGVVLQANPDEApEHRLANILAQRRARALLDHVDDLF 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap