4KNC


Conserved Protein Domain Family
ALGX

?
pfam16822: ALGX 
Click on image for an interactive view with Cn3D
SGNH hydrolase-like domain, acetyltransferase AlgX
ALGX is a family found in bacteria. The domain demonstrates catalytic activity similar to that of the SGNH hydrolase-like domain, with the typical Ser-His-Asp triad found in this enzyme. Alginate is an exopolysaccharide that contributes to biofilm formation. ALGX is secreted into the biofilm and is responsible for the acetylation of biofilm polymers that help protect them from host destruction.
Statistics
?
PSSM-Id: 318922
View PSSM: pfam16822
Aligned: 31 rows
Threshold Bit Score: 210.64
Threshold Setting Gi: 501160375
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KNC_B         38 LVQAQDDWLFRTTY----DLRTD----FGTSAEGWRELRALRDELKRKGIELVVVYQPTRGLVNREKLSPAEKAGFDYel 109
gi 81562633    99 VVFGKDDWLFYAGDnsieLYRNQrpfsALQLANTEAALALRMRPLQAANRSYLFVVVPDKHTIYPEMMPTYMSRRDPP-- 176
gi 123514151  105 VRQGCPGWLFLSDE----LELHRg--aDANAQARAHLVAQVREALAAQGVGLLVAVVPDKSRIEAEHLCGLRRPAVLQ-- 176
gi 81732330    99 VRQGCPGWLFLTDE----FRLNRd--aQANAQHKAQAVIDVQRSLKKRGIDLLVAVVPDKSRIAAAQLCGLYRPDVQQ-- 170
gi 501122600   86 VRAGCPGWLFLAEE----TLEVKg--gASHLEARARMAGMIAADLARRGITLVVLPVPDKVAMTPETSCALAVSSQAR-- 157
gi 501062478   88 VRAGCPGWLFYADE----IVEPRe--rEAPVAERIRLAAKIRDHLAARNIALVVLPVPDKALLAADRLCGLPVADLAA-- 159
gi 503059369   90 VRPGCADWLFLTDE----LQPHPd--sENAAQFRTTLAAKLNSRLAERGIKLLMVIVPDKTRIESAHLCGLKRSERFA-- 161
gi 501062477   41 LIIGKDGWLFPGWE----SLTVLd---RAGITANVALIKDAKAALAARGVTLVTLVVPLKARFSAARLPEGTSLSADVv- 112
gi 1043086243  53 VLRGKDGWLFPGWG----SLTQVd---RAGITESTRLITEARNLLAARGVKLQVLLLPDKVRFYADKMPDGKAMSADVq- 124
gi 302580519   39 VLVGRDGWLYFSHE----MTKAAv--eKPGIATSLEIIGKFNRVLKRKGVTLTIAMVPLKVRIYPEHLPTGMTLSNDTi- 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KNC_B        110 akKNYLATIARFRQAGIWTPDFSPLF---DekE--EhAYYFKGDHHWTPHGARRSAKIVAETLKQVp----GFEEIPKKQ 180
gi 81562633   177 --SQLDQVAALAEKDRLPVLDLRSTL---RqgKadG-QVYLKDDSHWTDWGAYLGYRRIMAALPLTd---lPVLDLDAKQ 247
gi 123514151  177 --DRVTRWIDDLRAKGVTAIDLTSPL---Qt---lGkDAYYRNDTHWNEAGAGVAARAVADAIRAS-----GVPLQPPRT 243
gi 81732330   171 --ARVAQWTNSLKAAGVDTLDLTATL---QplGe---TAYLRTDTHWSECGANAAARALALHLRKA-----GFQATPQRQ 237
gi 501122600  158 --DRLAAWHAHAAKLKLNEIDVTADW---Pa------PGFLRTDTHWDVSGAAFAAARVAAVVRRL-------DGEGKTQ 219
gi 501062478  160 --KRSAAWWEGSRGLGLDQVEIAPGF---P-----GaDGFLRTDTHWSPLGARLAATRVAEHVARK-------IGAGTQK 222
gi 503059369  162 --ARVANWQSALEEQGVAALDLTQAL---A--EqeG-ERYYHTDTHWNEAGANRSARVVASALRARh----WAGDAGGEA 229
gi 501062477  113 --GQYDFILDELKKAGIDTLDLRPAL---KsvEtgRqTSFYRADYHWTAWSSEAAADAVAAFIKTKv---pKLAGSPGGD 184
gi 1043086243 125 --GRYKQVLQALQAAGIPSFDDEAVL---RtvRdsGkDVFYRTDQHWTQAAADATAEATARMVQGEv---pQLAGSAGSG 196
gi 302580519  112 --TNYDRALSILKADGVDVIDLNSAFlrhKpkNssDlPLYYPLDTHWSPTGALLAAETIAAAIENTpslkeKINAIPPTK 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KNC_B        181 FESKRVGLLSKLGTFHK-AAAQLC-GNSYAT-----QYVDRFETEPVGAS------DSGDLFGDGGNPQIALVGTSNSG- 246
gi 81562633   248 F----AIPSDHAGDLAG-MAGLTR-RETTRLselpaDRCAFTASAYKPVGdd---iSIGRTFCPQAKYKIMFIGDSFTE- 317
gi 123514151  244 LRATPQPAAPRPGDLPR-LAGVDWlATVLQPp---mEIVSSHVYTPEAS-------KSDDLFGDTALPTLALIGTSYSRt 312
gi 81732330   238 FQTSIAPIAERPGDLVR-LAGLDWlPLSLQPa---aQSVAATQITELASDaaaggdNLDDLFGDSNLPNVALIGTSFSRn 313
gi 501122600  220 VTLTEGPDHLRPGDLMR-LANLTRtASWFGPa---pDTVRDISADIA---------RSGGLLDDAPAPDTVLAGSSYSLn 286
gi 501062478  223 VTLKESAPHARVGDLMR-LAGLERsWPWSGPe---pDQVPDVSVAIA---------RTGGLLDDVPAPAVVLAGSSFSRn 289
gi 503059369  230 VVLNTALTARP-GDLVH-LAGIDGlPAFLRPr----VELAQVTVLPPLAq------GSDDLFGEASAPTTTLIGTSYSRn 297
gi 501062477  185 KLGEWVTQRHL-GDLAErFLPPDQ-QKQVGP-----DLYTVRTPPAA----------KASLLDGGPAP-VHVVGNSFVQ- 245
gi 1043086243 197 LALGDTVTERRYGDLAE-LFLTAEeRK----------QIGREVYTVRRQa------PAKGLLDDEPAP-VHVTGHSMVQ- 257
gi 302580519  190 YKFTWLEASETPQVAAS-TFDLVK-HLPKAS-----QNFPLRNDRQFRVSkq--ssSESSLLGEVNKPDITLMGSSYSG- 259
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
4KNC_B        247 PAYNFAGFLEEFSGADILNNAVSGG-GFDSSLLAYMTSEEFHKNPPKILIWEFA 299
gi 81562633   318 ---ALVKYLSRSF-GEVVYVARSGF-KPSREIAPLIERE-----KPDLVIEELA 361
gi 123514151  313 S--GFVPQLEQALGAQVGNFARDGA-KFGGAAKHYFQSQAWKQTPPKLVIWEID 363
gi 81732330   314 S--GFVGFLQRELGAPIGNFAKDGG-EFSGAANVYFDNPAFRQTPPKLLIWEIP 364
gi 501122600  287 S--GFLESLQHALQREVVQRSEAGG-GFSGALLALLDKGPEALKPVKLVIWEWP 337
gi 501062478  290 S--GFLDYLQAASGYEVAQKSADGS-GFAGQLLAFLMDEPESLAQTRLIVWEFP 340
gi 503059369  298 S--NFVPFLERHLGESVANEAKDGG-DFAGAAIAYFGGVTFRSFAPRVVVWEVP 348
gi 501062477  246 PYLGFPQKLSNGLDRPVSLTWNPGNvGPWVTFLQAVGTPDFAKAPPQVLVWQFN 299
gi 1043086243 258 PYFGFPQKLSNLLDRPVSLNWKPGNvGQWTMLLEYLESPAFKSHKPQVLVWQMF 311
gi 302580519  260 AWTKFPAGLRYTLQRNILDISVEAPhGSWYGMELYLRNEAFQTHRPKLLIWEMP 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap