4B9G


Conserved Protein Domain Family
CssAB

?
pfam16831: CssAB 
Click on image for an interactive view with Cn3D
CS6 fimbrial subunits A and B, Coli surface antigen 6
CssAB is a family of CS6 pilins from E.coli, including both subunits A and B. It acts as a colonisation factor for the enterotoxigenic species pf E.coli to mediate bacterial attachment to the small intestinal epithelium. Both subunits in the fibre bind to receptors on epithelial cells, and that CssB, but not CssA, specifically recognizes the extracellular matrix protein fibronectin.
Statistics
?
PSSM-Id: 318930
View PSSM: pfam16831
Aligned: 3 rows
Threshold Bit Score: 255.877
Threshold Setting Gi: 411024261
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B9G_A        13 FIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGK 92
gi 487418991  39 FIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGK 118
gi 409905531 337 FIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGK 416
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
4B9G_A        93 FMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN 141
gi 487418991 119 FMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN 167
gi 409905531 417 FMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap