2WPV


Conserved Protein Domain Family
Get5_bdg

?
pfam16843: Get5_bdg 
Click on image for an interactive view with Cn3D
Binding domain to Get4 on Get5, Golgi to ER traffic protein
Get5_bdg is the binding domain at the N-terminus of Get5, or Golgi to ER traffic protein 5, in yeast, that binds to Get4. Together with Get3, this tripartite complex is involved in the insertion of tail-anchored proteins in the ER membrane.
Statistics
?
PSSM-Id: 318941
View PSSM: pfam16843
Aligned: 14 rows
Threshold Bit Score: 69.2905
Threshold Setting Gi: 754406715
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
2WPV_B         8 PEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKqNRAKK 59
gi 74693831    4 TEREFVNKFLTLAALEEPTRTRDYFKPLEQVKSIAVTLQPLKYKYN-KQSRP 54
gi 74607723    2 SELDFVGKFLSLAALNEPKLASNYRKPLHEVTNLGVSLPPLRYKYDpSKSHS 53
gi 403213334   2 SDKDFVTKFLTLATINKPALGPDFQKPLSEVKTLGVALPPLKYKYDpKRTHG 53
gi 410077409   7 SQREFVNKFLTLATLNEPIISSSYQKPLQDVTTLGVALPALKYKYNpKRTRT 58
gi 367007972   9 TELEFVSRFLTLATLSEPVFSKDYQKPLQEVTSLGVALPGLRYKYEpSRVRK 60
gi 410730493   4 AEQEFVSKFLTLTNLSESLLPGNYQKPLQEIVSLGVPLPALKYKYDpKRFNN 55
gi 255710483  42 PEKEFISKFLSLVAQQPIVLKSDFKTPMENITNLGVALPPLKYKYDhKRLKR 93
gi 366992119   4 TEPDFISKFLTLATLNEPALSSNYEKPLQEISSIGVQLPPLKYRYDpTKVKR 55
gi 363751214   4 AERDFVTRFLTLTSINEPALSKDYFKPLEEIQELGLSLKPLNYKYDhKRVKL 55
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap