Conserved Protein Domain Family
Stomagen

?
pfam16851: Stomagen 
Stomagen
Stomagen (epidermal patterning factor-like protein 9) acts as a positive regulator of stomatal development.
Statistics
?
PSSM-Id: 318947
View PSSM: pfam16851
Aligned: 7 rows
Threshold Bit Score: 77.6133
Threshold Setting Gi: 302764960
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002965901  10 DRRAMVGSTAP-SCTYNECRDCKT-ECRAEQVPLNGRNPKESAYRYLCVCR 58  Selaginella moellendorffii
XP_013602781  52 SRRHMIGSTAP-TCTYNECRGCRY-KCRAEQVPVEGNDPINSAYHYRCVCH 100 Brassica oleracea var. oleracea
XP_009412997 252 TRRLMIGSTAP-TCTYNECKGCRL-KCRAEQVPVDAGDPMNSAYRYRCVCH 300 wild Malaysian banana
ERN11813      73 ARRLMIGSTKP-TCTYNECRGCKTnKCRAEQIPVDANDPLNSAYHYRCVCH 122 Amborella trichopoda
XP_015649347  81 ARRMAIGSRAP-TCTYNECRGCRR-RCSVQEVPVDAGDPMNSAYHYRCICH 129 Japanese rice
KQL02581      38 gRRMLVGSRAPtTCTYNECRGCRH-RCSVQVVPIDASDPINSAYHYKCVCH 87  foxtail millet
XP_006645216  74 ARRMLIGSTAP-ICTYNECRGCRF-KCTAEQVPVDANDPMNSAYHYKCVCH 122 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap