Conserved Protein Domain Family
CAC1F_C

?
pfam16885: CAC1F_C 
Voltage-gated calcium channel subunit alpha, C-term
CAC1F_C is the C-terminal region of voltage-gated calcium channel subunit alpha in higher eukaryotes. The exact function of this domain is not known.This region lies immediately downstream from the CDB motif, pfam08673.
Statistics
?
PSSM-Id: 318975
View PSSM: pfam16885
Aligned: 8 rows
Threshold Bit Score: 429.72
Threshold Setting Gi: 768913270
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1485 GLRTLQDLAPEMRLAMAMEDEE--ALEGEMMEDeefFRSD----SVFSDV-P---PTPTMSTPRSTPMPPHLDQTTV--- 1551
gi 731504351  1296 GLRSLQDLGPEIRQALTCDTDE--EKEEQGQKG---EEEE----DEKDPEtY---QAPIGSQPPSRRSSMISVSLPV--- 1360
gi 861504415  1621 GLRSLQDLGPEMRQALTCDTEE--EEEEKEEER---QEGVeeeaEKDPET-Y---KGPVGSQPSSH--SRISVSLPV--- 1686
gi 768913270   579 hrvackrlvamnmplnsdgmvtfnatlfalvrtalkiktdgipeqeneelraiikkiwkrmkpklldevipphkeeevtv 658
gi 962012671  1497 GLKTLQDLGPEMRLALNEDLED--EEEALM------DGED----LEKNAA-Y---KAENGFGPETRRGSILT-------- 1552
gi 821494699  1587 GLKTLQDLGPEIRQALTCDLEE--EAEDANLGE---EPDRc-------------pQDALEAPSPTWHDSAPSVSLTMpae 1648
gi 545228815  1417 GLRSLQDLGPEIRQALTCDTDEeeEEE----GQ---EGEE----EEDEKD-SqtyKASMGSQPPSRRSSVISVSLPA--- 1481
gi 564398634  1389 GLRSLQDLGPEIRQALTYDTEEe-EEEEEAAGQ---EAEE----EEAENN-PetyKDSIDSQPQAQWNSRISVSLPV--- 1456
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1552 NIELPPRIR-NGSLMLEEA-------------------------------LldsrpasalseneVi-vEQPNRLSPLPS- 1597
gi 731504351  1361 GDRLPDSLClGPSDDYGRT-------------------------------S-------------N---SRQASMPQTGF- 1392
gi 861504415  1687 GDSLPDLPSpRPSDEDRGD-------------------------------P-------------K---SRHPSVPQPGS- 1718
gi 768913270   659 gkfyatfliqdyfrkfrkrkekgnftgetddtnpsalckaglktlqdlgpemrlalnedleedeeevmmeeeeeeleena 738
gi 962012671  1553 -----------PTGDGGVSngglihrvgslskmangnehdehlcrgdsvrS-------------SvshLRRASVKNSLTd 1608
gi 821494699  1649 EEREAVRR---PP----GA-------------------------------H-------------Sh-------------- 1663
gi 545228815  1482 GDRLPDSLSlAPSDDDGGA-------------------------------P-------------N---SRQSSVPQTGS- 1513
gi 564398634  1457 KEKLPDSLStGPSDDDGVA-------------------------------P-------------N---SRQPSGLQAGS- 1488
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1598 KWTSSHSKLTPLwilntnprqgaQNDSTGVCVYPps--psPDVAMQNGQVTegdvvpgghggatmggvmEAGvvhGVatd 1675
gi 731504351  1393 HTCRRSSEPLIF-----------TIPEEGSSKPK------GTKGQDKQDKK------------------EEA---SN--- 1431
gi 861504415  1719 HSHRRSSGVLMF-----------TIPEEGSPEPK------GTKGHDKQDEE------------------GEIp---D--- 1757
gi 768913270   739 ayksendfgpekerqgsalntptgpggvvgdggvsngglihrvgsltkmpngsdledhyrhdnkkrasfshhrsrhpsvr 818
gi 962012671  1609 SAHKRPSYYKYG-----------RRDSGDRSWRNgdvdvyGEQGYYSREED------------------NESi-tSR--- 1655
gi 821494699  1664 -----------------------------SASPKaeepplGAEGLAEQEEE------------------EDHspsQD--- 1693
gi 545228815  1514 HTHRRGSGVLIF-----------TIPEEGSSQPK------GTKGQEKQDEE------------------EEVp---S--- 1552
gi 564398634  1489 QPHRRSSGVFMF-----------TIPEEGSTQLK------GVQGQDNQNEE------------------QEVp---D--- 1527
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1676 gvvHGGSIIGeevvmggGVTeltytadqggvgsgdpqtavlpeqqwfpevpptqavvpdrTTE----CVAPVQPINLNgn 1751
gi 731504351  1432 ---LLSYLDE-------QAE----------------------------------------TPP----RLVLLPPHRPQ-- 1455
gi 861504415  1758 ---RLYYLDE-------QAG----------------------------------------TPPrtppHSVLLPPHRPQ-- 1785
gi 768913270   819 ngpldyslnrpsyykhgrrdsrdrywrrgaleafgdqtyysreedndslssrdrhypdepplypdhyeGLLY-----Shs 893
gi 962012671  1656 ---DRHYPDD-------LS---------------------------------------------------LYRDHRDGha 1674
gi 821494699  1694 ---RQAHRND-------LTQ----------------------------------------RPH----HILLPPPPRPPre 1719
gi 545228815  1553 ---QLSYLDE-------QEG----------------------------------------TAL----RPILLPPHRPQry 1578
gi 564398634  1528 ---WTPNLDE-------QAG----------------------------------------MPS----NPVLLPPHWSQqh 1553
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1752 gyqgN-----IQdagnyngsfpgngyngngtngtdypgnrcssngystngyngngynsngfngngynnneysgngfaaRR 1826
gi 731504351  1456 ----R-----YVdgy------------------------------------------------------------hapHR 1466
gi 861504415  1786 ----R-----YGngh------------------------------------------------------------hmpRR 1796
gi 768913270   894 sytnG-----YGegr------------------------------------------------------------rttRR 908
gi 962012671  1675 pysnGsygdsYSegr------------------------------------------------------------rttRR 1694
gi 821494699  1720 plgqsg----------------------------------------------------------------kplgphprRR 1735
gi 545228815  1579 vdg-----------------------------------------------------------------------hhvpRR 1587
gi 564398634  1554 vng-----------------------------------------------------------------------hhvpRR 1562
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1827 RMLPPTPlgRKPNFNIQCLRRQGSNEDLPVPGTYH--Q--NSPPCRARAqitqthnsfdsrrssissgissaSWANNQaR 1902
gi 731504351  1467 RLLPPTPagRKPSFTIQCLRRQGSCEDLPIPGTYH--RerNSGPSRVQG-----------------------SWATPP-Q 1520
gi 861504415  1797 RLLPPTPagQKPSFPIQCLQRQGSCEDLPIPGTYHrgQ--KLGLSRAQG-----------------------SWATPP-Q 1850
gi 768913270   909 RLLPATPtgRKPSFNIQCLRRQGSSDDLPMPGTYH--P--TSPPRRSST-----------------------PWANPCpR 961
gi 962012671  1695 RLLPATPtgRKPSFNIQCLRRQGSSDDLPIPGTYH--P--TSPPRRARPqafssydsrrs--sarsavvssaSWAKPCpR 1768
gi 821494699  1736 RLLPPTPatRKPSFTIQCMQRQGSCDDFPIPGTYQrgG--SSGRHHAHG-----------------------SWATPP-Q 1789
gi 545228815  1588 RLLPPTPagRKPSFTIQCLRRQGSCEDLPIPGTYHrgR--NSGPSRAQG-----------------------SWATPP-Q 1641
gi 564398634  1563 RLLPPTPagRKPSFTIQCLQRQGSCEDLPIPGTYHrgR--TSGPGRAQG-----------------------SWAAPP-Q 1616
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1903 RGRLLYAPLILVNEvggtqAMWsdtngsttlpasaR---------PGWlg--------------------saMAG----- 1948
gi 731504351  1521 QGRLLYAPLLLVEE-----GAA-------------G---------EGY------------------------LGK----- 1544
gi 861504415  1851 RGRLVYAPLLVVEE-----GAA-------------G---------EDY------------------------LGK----- 1874
gi 768913270   962 RGRLLYAPLILVEE-----EEG-------------SvtitgaaprPAW------------------------YGGpagts 999
gi 962012671  1769 RGRLLYAPLILV-E-----EEG-------------S---------PPWggegknggaargtadgppwfggsvGSS----- 1815
gi 821494699  1790 RGHLLYAPLLLVEE-----GRL-------------Q---------GDYa-----------------------KGG----- 1814
gi 545228815  1642 RGRLLYAPLLLVEE-----GAA-------------G---------EGY------------------------LGK----- 1665
gi 564398634  1617 KGRLLYAPLLLVEE-----STV-------------G---------EGY------------------------LGK----- 1640
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040697938 1949 VPQQPRAYTTLRVPSQNSPGYIE-RGSADSLVESILISEGLGLYAKDRKFVDFAKREIADACQMTVDEMENAATDLLCRG 2027
gi 731504351  1545 SSGPLRTFTCLHMPGTHLEPNHGkRSSADSLVEAVLISEGLDLFAQDPHFVALAKQEIADACRLTLDEMDSTASDLLAQG 1624
gi 861504415  1875 SGGPLRTFTCLHVPRTHSNPSYSkRSSADSLVEAVLISEGLGLFAQDPCFVALAKQEIADACRLTLDEMDSAASDLLAQG 1954
gi 768913270  1000 APPPYRAYTTLRVPSQLGAQLTEkRGSADSLVEAVLISEGLGLYARDPKFVAFAKREIADACHMTVDEMESAANDLLSTG 1079
gi 962012671  1816 APPPYRAYTTLRVPSQLGAPFAEkRGSADSLVEAVLISEGLGLYARDPKFVAFAKREIADACHMTVDEMESAASDLLSSG 1895
gi 821494699  1815 SRGPLHTYARLHVPSTHIAPGPGkRGSADSLVEAVLISEGLGLFARDPRFVALTKQEIADACRLTLDEMDSAACDLLALG 1894
gi 545228815  1666 SSGPLRTFTCLHVPGTHSDPSHGkRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDSAASDLLAQG 1745
gi 564398634  1641 LGGPLRTFTCLQVPGAPSDPSHRkRGSADSLVEAVLISEGLGLFAQDPRFVALAKQEIADACHLTLDEMDSAASDLLAQR 1720
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|...
gi 1040697938 2028 RAGQ---------------------PTGRFDEDLSDEMNCVIS 2049
gi 731504351  1625 ASLLysee--------------esiLSSFDEEDLGDEMACIHA 1653
gi 861504415  1955 TCSLysde--------------esiLSCFDDDDLGDEMACVHA 1983
gi 768913270  1080 SHGLlanatdpaa----lysdeepiRTGHDEDELADEMACVTS 1118
gi 962012671  1896 SHDFlntigddpa---alysdeepiRTSREEEELADEMACVTS 1935
gi 821494699  1895 TTGPppaqpqmwapmgsdedeealgATRAEEEELADEMVCIpv 1937
gi 545228815  1746 TSSlysd--------------eesiLSRFDEEDLGDEMACVHA 1774
gi 564398634  1721 TTSlysd--------------eesiLSRFDEEDLGDEMACVHA 1749
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap