Conserved Protein Domain Family
Glu_dehyd_C

?
pfam16912: Glu_dehyd_C 
Glucose dehydrogenase C-terminus
Statistics
?
PSSM-Id: 319000
View PSSM: pfam16912
Aligned: 20 rows
Threshold Bit Score: 245.703
Threshold Setting Gi: 500039798
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 374110679 145 PVGFLVEPISITEKAIEHAAA-TRSAFD-WRPESVFVLGNGSLGLLTAAMFRt-TMGYDRVYCLGRRDRPHPSIDILDEL 221
gi 121687388 143 QVGFLVEPLSVVNKAIELATA-SRSSFT-WEPTSALVLGNGSLGLLMLAHITs-TDTYERCYCLGRRDRPDPTIDIIERL 219
gi 374110725 144 EYGFLVEPLSITEKANEHAYA-TREPFD-WRPDSACVLGNGSLGLLTLWMLD---QEYDRTYCVGRRDRPDPTVDIIDEI 218
gi 374110689 144 AYGFFVEPASLVEKALDQTEA-ARSGFD-WRPSSAFVLGNGNLGLLALTRLEtgDE-FERTYCLGRRDRPDPTIDVIENV 220
gi 374110735 140 DVAVLTEPLSVVEKGIDVALSvGGSRFE-WRPRSALILGAGPIGLLSTMVLRl--mGLLTT-TVATRPPDSLKARLVREL 215
gi 506243449 144 PYGIFVEPLSNTEKALEHARA-TRSAFD-WYPESAAVLGNGPLGLLTLWQL---TQEFDRTYCLGRRDRPDPTIEFIDEV 218
gi 500234721 145 RVGMLLEPTSIVAKAWEHIER-VGHRAR-WDPRTTLITGAGPIGLLA-ALLAt-QRGL-TVHVLDR-NTTGPKPDLVRAL 218
gi 503604503 145 DVGMLLEPTSVVAKAWEQVDA-VGGRAW-FEPRTALVTGAGPIGLLA-ALIGv-QRGLD-VHVLDRHAE-GRKPDLVGAL 218
gi 503102347 143 DVAVLTEPLSIVEKGIDLAIRlGKARFEsWSPRRVLIMGAGPIGMLALMVMRl--RGFTDVTVTATRPYDSLKAKLVKEI 220
gi 517660699 145 RVGMLLEPTSIVAKAWEHIER-VGHRAR-WDPRTTLITGAGPIGLLA--ALLatQRGL-TVHVLDR-NTTGPKPDLVRAL 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 374110679 222 GVTYIDSRETPVPEVPEVYEPMDLVYEATGYAKHAFESIEALAPNGVAALLGVP-ND-W-SFEVDGGRLHREMVLHNKAI 298
gi 121687388 220 GATYVDSRKTPVDMIPSTYESMDFICEATGHAPHAFKTIDALAPNGVGALLGVP-ES-S-SFEIDGGALHNELVLHNKAL 296
gi 374110725 219 GSTYVDSRETPVDELPGAYEAMDYIYEATGFAPHAFQTVKALDQNGVGVLLGIP-EP-W-EFEVDGGSLHNEIVLHNKCL 295
gi 374110689 221 GGTYVDSRELSLDEFPAVHEPVDFAFETTGHPAHAVEAVDALAPNGVVTLQGIPgSS-S-TVEIDGGAFHTDLVVTNKAI 298
gi 374110735 216 GGVYVDSALSSIEGV------FDLVVEATGSPQVMVDGLRHLAPNGVMVLLGVY-PP-G-GVINDLGNVLTDSVLNNKVL 286
gi 506243449 219 GATYIDSRETPVDEIPDEHEGMDFIYEATGYAPHAFETVQALAPNGVGALLGIP-GS-W-DFEIDGGSLHNDIVLHNKCL 295
gi 500234721 219 GATYHT------ESVNEVDLQPDVLVECTGDPRVVLDSMCKVGPTGIVCLTGMS-TG-GrTIDFDAGALNRTLVLENTVV 290
gi 503604503 219 GATYHTEDLATVSDA----VQPEVLIEATGAPPVITAALTATRPYGVTVLTGVT-TP-GrTVPLDVGAANREIVLENDAI 292
gi 503102347 221 GATYVN---TNVDQISGE---FDIVIEATGSTNAAYEALRHLGADGVAVLLGIY-LD---SKNVNIGPLLDD-WRKNKLI 289
gi 517660699 219 GATYH------TESVNEVDLQPDVLVECTGDPRVVLDSMCKVGPTGIVCLTGMS-TGgR-TIDFDAGALNRTLVLENTVV 290
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 374110679 299 VGSVNSNRDQFASAVDTLAGLPSW---V---IEDVVSGVYGLEEYERAFSdptddataDDD-TTIKTAVEF 362
gi 121687388 297 IGSVNSNITHFKTASDDLQTFPEW---F---IDSLITDVYPLSEFRYAFD--------NNDdTTIKTAVQL 353
gi 374110725 296 IGTVNSHVSHFEDAVETLQELPAW---L---LDDLVTTVTDPEHVEAAFE--------DGD-DQIKAVVEF 351
gi 374110689 299 LGVVNARRSHFRAAAEWLAETPES---V---LDALVTGVYGPDEIDEAFA--------DSA-ETIKTVVSF 354
gi 374110735 287 VGSVNAGVKHFELGLRHMAEAKGR---FgdwLSRLITKRATLDNYQEAYS--------WTH-DDIKTVLEI 345
gi 506243449 296 FGSVNAGIRHFAEGAAVVEAMPDD---L---LDHLVTTVTDPENVEPAFE--------DGD-DQIKAIVEF 351
gi 500234721 291 IGSVNSNRRHWEQAAAALARADHS---W---LDALITHRIPMSDFTTAYE--------VND-GTIKVVLDL 346
gi 503604503 293 VGSVNANMGHYEAAADVLARADLD---W---LRGLVTRRLPLERALEAFD--------DGS-DDVKVVVEL 348
gi 503102347 290 IGATNASIRAFEMGVSDLVKAKFEfggW---VRKLITKEVTLDEYEYAYN--------WGH-EDIKSVIQI 348
gi 517660699 291 IGSVNSNRRHWEQAAAALARADHS---W---LDALITHRIPMSDFTTAYE--------VND-GTIKVVLDL 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap