Conserved Protein Domain Family
PknG_rubred

?
pfam16919: PknG_rubred 
Protein kinase G rubredoxin domain
This rubredoxin domain is found at the N-terminus of protein kinase G, and is essential for kinase activity.
Statistics
?
PSSM-Id: 319005
View PSSM: pfam16919
Aligned: 16 rows
Threshold Bit Score: 154.102
Threshold Setting Gi: 326659640
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81831591   20 PGTQPA-----EvgDDA--------QAGAATGRLQ---------ATQA-------LFRPDFdddddDfpHISLGALDTDS 70
gi 505117366  11 PGTQPAt---fD--DLG--------MDSASTLRPM---------ATQA-------IFRPHLd---dDvdSTSVGTEDTEP 58
gi 662769557   5 PGTQPAsladlD--ELD--------DESVATVRPM---------ATQA-------VYRPDFd---dTdrS---TTAATEP 52
gi 898668771  17 PGTQPA-----SlaDLD--------VDSASTMRPI---------STRA-------VFRPPd-------sTQPATQPTTQP 60
gi 503593247  26 PATQRA--------DVL--------AESSSVRRPM---------STQA-------IFRPREg---------SNAAISADD 64
gi 493413553  48 PGTQRA-----D--LAAlvdtgmtsSGGRTTTSPVt-------gSTDP-------VVRSGP--------VIPTEALASVG 98
gi 504801701  35 pkpvapaanpaaepphT--------ELARAESRPA---------KSAAaaetvvgVERPN---------SEPGSAATMRT 88
gi 344315305  53 GDSASQ----------R--------SASRSSSRS----------SRSS-------TSRRSVsgrlsR--SLSGTATSRSV 95
gi 326659640  55 gdsssQ----------R--------SGSRASARSS---------SRSS-------TSRRSVsgrlsR--SLSGASTSRSV 98
gi 764936811  54 rpgRRA-----D----P--------DVGTQAVAPVftvgvdpddRTDR-------VVRSRP--------AVPHPEPDSGP 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81831591   71 A-DRM-TVATQALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWN--CGKPVGRSTKKSKGTSEGWCPHCGS 146
gi 505117366  59 H-DHL-TAMTRALSPTRRLGGGLVEIPRVPAKDPLDALMTNPVVAESKRFCWN--CGRPVGRSTPDGHALSEGWCPHCGS 134
gi 662769557  53 SaTTM-GVLTRPRSPIRKLGGGLVEVPRVYERDPLTALMSNPVVAESKRFCWN--CGKRVGRATREGPGRSEGTCPHCGS 129
gi 898668771  61 E-VRA-TTTRVLLSPTRRLGGGLVEIPRVPEIDPLEALMTNPVVEESKRFCWN--CGKPVGRSTTDSPAQSEGICPSCGS 136
gi 503593247  65 D-SRV-AAVVRTVAPRRRLGGGLVEIPRVPEINPLEALMPDPVVAEAKRFCWN--CGRPVGRSTGDVKGASEGWCPHCGS 140
gi 493413553  99 H-TRRlVPKRRPQVHDRRLGTGLVELPKVVDIEPADAVLDFPVIPEGKRTCWR--CGRPVGRNDGEGAGDLAGTCPHCGA 175
gi 504801701  89 S-GRS-FRTARSRPTVRRLGGGLVPIQSVTPADPRAAVLTDPVVSEGRRFCWR--CGSPVGRASATRPAVTAGTCETCSA 164
gi 344315305  96 S-VRSsGSASGSVSGRNRLGAGLVLVPDVPRPDPRTAVMENPEVPERKRFCSRsdCGAPVGRARGERPGRTEGFCTKCGH 174
gi 326659640  99 S-VRSsGSTS-AASARGRLGVGLVEVPDVPRPDPRTAVMENPEVPERKRFCSRsdCGAQVGRSRGERAGRTEGFCTKCGH 176
gi 764936811 102 L-GRRlVPHRRPPVHERRLGSGLVEMPKITDIEPADAVIDDPVIADSKRFCWR--CGKPVGRREGDGAGPPTGDCGNCGA 178
                        170
                 ....*....|....*..
gi 81831591  147 AYSFLPQLNPGDIVANQ 163
gi 505117366 135 SYSFLPQLSPGDEVADQ 151
gi 662769557 130 PYSFLPQLSPGDMVVGQ 146
gi 898668771 137 SFSFLPQLNPGDVIAGQ 153
gi 503593247 141 PYSFLPQLKPGDMVAGQ 157
gi 493413553 176 RYSFVPGLAPGTVVAGQ 192
gi 504801701 165 PYDFRPSLHEGDMVSGQ 181
gi 344315305 175 PYSFVPKLHSGDVVHGQ 191
gi 326659640 177 PYSFVPKLTGGDIVHGQ 193
gi 764936811 179 RYSFVPGLAPGTLVADQ 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap