Conserved Protein Domain Family
Hol_Tox

?
pfam16935: Hol_Tox 
Putative Holin-like Toxin (Hol-Tox)
Hol_Tox is a family of small proteins (34-48aas) with a single TM region. Members can exhibit antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria.
Statistics
?
PSSM-Id: 319017
View PSSM: pfam16935
Aligned: 2 rows
Threshold Bit Score: 76.8942
Threshold Setting Gi: 348600786
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 497702586  1 MVAILEGGGAYGFKTVNPDPRKGEASCPVSDALQLMLAFGGFILGILTFVVLLIEKISKK 60
gi 348600786  1 MTVAIFFESEVVRMCVLTKTKERRSLLSAFETIQVILGFGTFTIALIALVVELLKNDRKK 60
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap