Conserved Protein Domain Family
Ferredoxin_N

?
pfam16947: Ferredoxin_N 
N-terminal region of 4Fe-4S ferredoxin iron-sulfur binding
Ferredoxin_N is a short domain that is often found at the N-terminus of 4Fe-4S ferredoxin iron-sulfur binding domain proteins from Archaea and a few bacteria.
Statistics
?
PSSM-Id: 319022
View PSSM: pfam16947
Aligned: 17 rows
Threshold Bit Score: 80.9013
Threshold Setting Gi: 491746527
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 121724292  27 HPMgEEWEEEMREKLEETEYDADLGMEMAEDAMRLIQGELSEAEFHDRYNDAVVEEFDVDDRPTA 91
gi 74518982   10 TPI-EEWEDEATAMLDGVEYDTDLGLRMARDAIRVSNGELSDAEFHEKYHEAVLAEFGADERPTK 73
gi 74569597   10 EPI-PDWEETADSMLADCGYDAQLGKEMAADAIRVANGDLSEATFHERYHDRVTAEFGCDDRPTE 73
gi 502502881   9 HEPiPEWDEVADEILDGCGYDPDLGKRMAEDAIKITNGELTEQEFHEKYHEEVKAEFGTDERPTK 73
gi 491746527  16 gidpAIWEETADEILDSGPYDAELGKRMSRDAVRVTLGHLSEEEFYEKYHDDVIAEFGIDERPIE 80
gi 433290712  10 HPLgPEWEADLEATLDETEYDTELGLAMAEDAMAVTAGELSEETFHERYHEAVLSEFGQDDRPTA 74
gi 433289928  11 HPLgAEWESELTSMLDDTEHDTELGLAMAEDAQRLVAGELTEAEFQEKYHEQVLDEFGEDERPTA 75
gi 909698641  16 HRLeDDWQTRLEGLLEDTDYDAELGLEMAQDARRVTAGELTEAEFYDRYHEAVVAEFGKDDRPLe 80
gi 445624443  18 DA--AVWEETADELLADSPYDPKLGKEMSRDAVRVSTGRMTEAEFHEKYHDAVLEEFGVDDRPId 80
gi 490140824  10 TPL-DEWETEAANILDGGDYDAELGLRMARDAIRVSNGELSDEAFHEKYHEAVVAEFGEDARPTE 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap