Conserved Protein Domain Family
OFeT_1

?
pfam16955: OFeT_1 
Ferrous iron uptake permease, iron-lead transporter
OFeT_1 is a family of conserved archaeal membrane proteins that are putative oxidase-dependent Fe2+ transporters.
Statistics
?
PSSM-Id: 319028
View PSSM: pfam16955
Aligned: 7 rows
Threshold Bit Score: 243.139
Threshold Setting Gi: 121722407
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121722407   2 DFSVLLASLGISILELSEASAVAVIFQGIYKNSKPFLYAIAGILIVLVPVFTLGQYIVLLPINYVLLVAAVILAYFGYKL 81
gi 74538810    2 DVSVFLAALGISLLELTEAGAIAAIYHNIYKNNLPFIYAVLGVAIVLIPTFTLGKLIYLVPLNYVLLASAVILFYFGYRL 81
gi 74573732    2 DLGVFFASLGISLLELSEAGAVAAIYHNILKNNLPFIYAIAGVLIVLIPTFTLGKYIYLVPINYFLLVAAIILFYFGYRL 81
gi 307550890  17 DFGIFFAAFGISLLELSEAGAVTAIYQGIYRGFKPVLYAIAGVLLVLIPTFTVGRYIIYLPLDYVLAVSSVILFYFGYRL 96
gi 499597891   2 DFSVLLASLGISILELSEASAVAVIFQGIYKNSKPFLYAIAGILIVLVPVFTLGQYIVLLPINYVLLVAAVILAYFGYKL 81
gi 500928046   2 DIGVFLAALAMGTLELSEAGAVSAIYAGAYKSWIPYLYGALGVSVVLLPTFTLGKFIELLPIQYVLVVGAVILAYFGYRL 81
gi 919588165   2 DFGIFFAAFGISLLELSEAGAVTAIYQGIYRGFKPVLYAIAGVLLVLIPTFTVGRYIIYLPLDYVLAVSSVILFYFGYRL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121722407  82 LRSARRSFKGSKKKH--EEKEEGIMTVFVVSATEALEAGLVILALIPQSFSSALLGTGIAVIIVIALTIALRSQIMKIRV 159
gi 74538810   82 IRSARRSFKGIKKKGg-EEKEEGLSVVFTVSAIEGLEASLVILALIPQSYSSAVMGAILASVLVVILTAILKSQVARIRL 160
gi 74573732   82 IRSARRYFKKQFKRKe-EEKEEGIGVVFTVSAVEGLEAALVILALIPQSYFSALLGTIISGILVVILTALLKAQIAKIRL 160
gi 307550890  97 LRSARRYFKRTGRGKggEEERGDLAVVFTVSAIEAFEAALVLIALIPRSYSSTLIGTLLAAAIVVILTAVIKDQIARIRL 176
gi 499597891  82 LRSARRSFKGSKKKHe-E-KEEGIMTVFVVSATEALEAGLVILALIPQSFSSALLGTGIAVIIVIALTIALRSQIMKIRV 159
gi 500928046  82 IRSARRSFKGIRKHH---EEKEGMGVVLVVAITEALEDALVALALIPQSYSSTLLGTGISAILVLGLTALLKNQIARIRL 158
gi 919588165  82 LRSARRYFKRTGRGKggEEERGDLAVVFTVSAIEAFEAALVLIALIPRSYSSTLIGTLLAAAIVVILTAVIKDQIARIRL 161
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 121722407 160 PHLKFVLSALLFGLATLFVAEAL-VDIDEVFLPLFFVIYLGVNYLVIK 206
gi 74538810  161 PHLKFVLSALLFSLGTLWISEVV-FDIPDLILPLFFLAYLGINYVIIK 207
gi 74573732  161 PHLKFVLSALLFSLGSMWLLEIF-TDITEAFLAIFFVIYLGINYLIIK 207
gi 307550890 177 PHLKYVLSALLFSLGTLWAIEAAgLDLTDLVLIPFFLAYLGINYLIIK 224
gi 499597891 160 PHLKFVLSALLFGLATLFVAEAL-VDIDEVFLPLFFVIYLGVNYLVIK 206
gi 500928046 159 PHLKFVLSSLLFSLASLWILEVA-LDVTELVILPLFLLYLGVNYLIIK 205
gi 919588165 162 PHLKYVLSALLFSLGTLWAIEAAgLDLTDLVLIPFFLAYLGINYLIIK 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap