Conserved Protein Domain Family
Mal_decarbox_Al

?
pfam16957: Mal_decarbox_Al 
Malonate decarboxylase, alpha subunit, transporter
Mal_decarbox_Al is a family of Na+-transporting carboxylic acid decarboxylases.
Statistics
?
PSSM-Id: 319030
View PSSM: pfam16957
Aligned: 21 rows
Threshold Bit Score: 1048.83
Threshold Setting Gi: 123394734
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146   7 WDKLATDTRQRMEAAAKYi---GPGKQVKKEDTVALLKAVIRSFDRVNIEGNNQKQADYLADCLLQVDPKEINNLHMVQS 83
gi 81379969    4 WNEARAARAARLAAAAPL----ARGKRVAARDATALLEAVLRPGERVCIEGDNQKQADLLAAALAAVDSAKVHGLHMVQS 79
gi 123626273   9 WDSLRQNRARRLERAASLglagQNGKEIPVDRIIDLLEAVIQPGDRVCLEGNNQKQADFLSESLADCDPARINHLSMVQS 88
gi 81792684    5 WDTQAESRRQRLQRAAALa---PRGRVVAADDVVALLEAVIEPGDRVCLEGNNQKQADFLARCLTEVDPTRVHDLHMVQS 81
gi 489696861   4 WGRERAARDARIEAGRAH----AAGKIVTAANVVALLEAILQPDDRVCLEGDNQKQADCLARGLSQCDPARVHDLHMVQS 79
gi 500197767   4 WNLLSENRGKRIARGLAI-----TGRIADPGKIVALLEAVIESGDRVCLEGNNQKQANFLAGALCALDPARVHDLHMLLS 78
gi 500095883   8 WATKKALKVERINSVQHI----SHGKVIPTEQMVAALECLLHIGDRVILEGNNQKQADFLARALEKVDSTKVNNLHMIMP 83
gi 505248116  11 WDTRARNRARRLERAASL----ANGRNVAPENIVALLEAVIEPGDRLCVEGNNQKQADFLSRALTKTDPSRVRDLHLVQS 86
gi 524862880  11 WNTRGEDTAARLKDGSAY----AKGKIVAAEDTVKLLEAVLRPGDKVNIEGDNQKQADFLAKQLCEVDPTKVHDLHMIQS 86
gi 501559511  14 WTRLEQSYRGRMERGNAI----SGHKIVPHQDAVALMEAVIEPGDRVCIEGNNQKHADFLAAELARCSPERIHGLHIVQS 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146  84 CVPLPVHLDMFEKGIAKKLDFAFGGPQAARVAKFISEGKIELGAIHTYLELFGRYFLDLTPRVSLICAYEADREGNLYTG 163
gi 81379969   80 GVVLPEHLDVFERGIAKRLDYAYSGPQSQRIAKLLFGGGIELGAVHTYLELFARYFIDLTPHVALIAAVSADADGNLYTG 159
gi 123626273  89 VLALPSHVDLFERGLATRLDFSFSGPQGARLAKLVQEQRIEIGAIHTYLELFGRYFMDLTPNVALIAAQAADAEGNLYLG 168
gi 81792684   82 VLSLPAHLDVFERGIAKRLDFSFSGPQAARLAGLVSEGRIEIGAIHTYLELFGRYFIDLTPRIALVTAQAADRHGNLYTG 161
gi 489696861  80 GIVLPEHLDIFEQGIARRLDYSYSGPQGARIARMLYGGHIELGAVHTYLELFARYFVDLTPNVALIAGVSADRDGNLYTG 159
gi 500197767  79 VLALPEHLDIFDKGIASRLDFSFSGPQAVRLARLVATGKINIGAIHTYLELFGRYFIDLTPRVALVAAQAADRQGNLYTG 158
gi 500095883  84 SVSLPEHMNIFEKGIASKLDFAFAGQQSVRISQMLEDGILEIGAVHTYVELYARLYCNLIPNVALVCGFKADKHGNLFCG 163
gi 505248116  87 VLALPEHVDIIESGQVSRIDFSFSGPQAGRLARLVESGRITIGAIHTYLELFARYFVDLTPQVALVAAQAADREGNLYTG 166
gi 524862880  87 TLSIPEHLDVFEKGIAHKLDFAYAGSQGKRLAQMVQNGGVELGAIHTYLEMYSRYFIDLVPRVSLVTADAADAEGNIYTG 166
gi 501559511  90 NIALPTHLDVFENGLAEKLDFCYSGPQGVRISRLVKDGQVKVGAIHTYLELYSRYFCDLTPHVSFIAADAADRDGNLYTG 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146 164 FNTEDTPVIVEATKFRQGIVIAQVNKIVDK---LPRVDIPAGWVDAVVESPRPFFIEPLFTRDPGLITDNHILLAMLALK 240
gi 81379969  160 PNTEDTPTVVEATAFKDGIVIAQVEKIVER---VPRVDIPGDRVHFVVEAGRPFYVEPLFTRDPAGITETQILTAMLAIK 236
gi 123626273 169 PNTEDTPAIVEATAFKGGIVIAQVNERLDK---LPRVDVPADWVDFTVLAPKPNYIEPLFTRDPAQITEVQVLMAMMAIK 245
gi 81792684  162 PNTEDTPVIVEATAFKGGIVIAQVNEILDT---LPRVDIPADWVDFVTHAPKPNYIEPLFTRDPAQISEIQVLMAMMAIK 238
gi 489696861 160 PNTEDTPTVVEATAFKNGVVVAQVNEIVDR---VPRVDIPGDRIDFVVEADRPFYVEPLFTRDPAAMTETQILMAMMAIK 236
gi 500197767 159 PNTEDTPAIVEATAFKNGIVIAQVNEIVDV---LPRVDIPADWVDFVVPAPTPHYIEPLFTRDPALISEVQVLMAMMAIK 235
gi 500095883 164 GSTEDTPSLVEAPAFKDGIVIAQVNEIVDEttdLPRVDIPGDWIDFIVQADKPFYMEPLFTRDPRLIKDTHILMGMMAIK 243
gi 505248116 167 PNTEDTPAIVEATAFKGGIVIAQVNEIVDN---LPRVDIPADWVDFTVAAPTPHYVEPLFTRDPALITETQVLTAMIAIK 243
gi 524862880 167 FSTEDTPAIVEATKFNQGIVIFQVNKIVDK---LPRVDIPADWVDYVIESPTPYMLNPLFTRDPAKITNERILKAMMAIK 243
gi 501559511 170 VNTEDTPAIVEATAFKSGILIAQVNRIVDR---VPRVDVPGDWVSYVIESPKPYYIEPIFTRDPAVITEIQILMAMMVIR 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146 241 GIYGEYKVKRLNHGIGFLTSAIELILPTYGEELGLKGQCCTHMVLNPHPTMIPAIEAGWVDTIHCFGGELGMEDYVRARS 320
gi 81379969  237 GIYARYGVKRLNHGIGFNTAAIELLLPTYGERLGLKGQVCTHWALNPHPTLIPAIESGWVEQIHCFGSEVGMDDYIRARS 316
gi 123626273 246 GIYAEYGVTRLNHGIGFDTAAIELLLPTYAADLGLKGKICTHWALNPHPTLIPAIEAGFVESVHCFGSEVGMDDYISARS 325
gi 81792684  239 GIYAEYGVDRLNHGIGFDTAAIELLLPTYAESLGLKGKICRHWALNPHPALIPAIESGFVQSVHSFGSELGMEKYIAARP 318
gi 489696861 237 GIYAEYGIRRLNHGIGFGTAAIELLLPTYAERLGLKGQIATHWALNPHPTLIPAIESGWVKQVHCFGSEVGMDRYIRERS 316
gi 500197767 236 GIYAEYGVERINHGIGFDTAAIELILPTYAESLGLKGKIGRHWALNPHPALIPAIEAGFVESVHSFGSELGMERYIEARP 315
gi 500095883 244 GIYAKHKVQTLNHGIGFNTAAIELLLPTYGESLGLKGKICKHWLLNPHPTLIPAIESGWVESVHSFGGELGMEEYIRERS 323
gi 505248116 244 GLYAEYGITRLNHGIGFDTAAIELLLPTYAADLGLKGKICTHWALNPHPTLIPAIEAGFVQSVHSFGSEVGMERYVAARP 323
gi 524862880 244 GIYAEYGVKVLNHGVGFDTAAVELILPTFAENLGLRGKICTHWVLNPHPTLIPAIETGWAQAIYSFGSEVGMEEYIKARS 323
gi 501559511 247 GIYEKYGVTRLNHGIGFDTAAIELILPTYAADLGLKGKICRYMSVNPCPTLIPAIESGFIDGIHCAGSEVGMSDYVAARS 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146 321 DVFFTGPDGSLRSNRAFAQTAGHYALDMFIGGTLQIDKFGNSSTATANRVAGFGGAPNMGCDPKGRRHVTDSWLKCGQEV 400
gi 81379969  317 DIFFTGADGSLRSNRAFCQTAGLYACDLFIGSTLQIDLAGHSSTVTAERIAGFGGAPNMGSDARGRRHPSEPWLKAGEEA 396
gi 123626273 326 DIFFTGADGSMRSNRAFSQTAGLYACDMFIGSTLQMDLAGNSSTATLGRITGFGGAPNMGSDPHGRRHASPAWLKAGREA 405
gi 81792684  319 DVFFTGADGSMRSNRALSQTAGLYACDMFIGSTLQIDLQGNSSTATRDRIAGFGGAPNMGSDARGRRHASAAWLKAGREA 398
gi 489696861 317 DIFFTGADGSLRSNRAFCQTAGLYACDLFIGSTLQIDLAGHSSTVTQNRVAGFGGAPNMGSDPHGRRHPSDTWMKAGREA 396
gi 500197767 316 DVFFVGRDGSMRSNRAMSQVAGHYACDMFIGSTLQIDMQGNSSTATLGRISGFGGAPNMGSDARGRRHPSAAWLKAGEQA 395
gi 500095883 324 DVFFTGPDGSMRSNRTMCQLAGQYAADMFIGATLQMDAEGNSSTVTRGRLSGFGGAPNMGHDPRGRRHSSEAWLDLIt-- 401
gi 505248116 324 DVFFIGPDGSMRSNRAFCQAAGHYACDLFIGSTLQLDLNGNSSTATKGRIAGFGGAPNMGADARGRRHASQAWLRAGREG 403
gi 524862880 324 DIFAIGPDGTMRSNRAFAQAAGHYAADMFIGSTMQIDRFGNSSTATKNNVAGFGGAPNMGCDAKGRRHVTEAWKKAGEEV 403
gi 501559511 327 DVFFIGRDGSMRSNRVFCQLAGHYA-DLFIGSTLQIDLEGNSSTATHNRITGFGGAPNFGSESRGRRHASPSWLLAGQEA 405
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122477146 401 Pnm-hDLIGDMPRGKRLVVQGVETFGEARAPSFVDKLDAWKLAENAKLELPPVMIYGDDVTHIVTEDGIAYLNRAPNMET 479
gi 81379969  397 Da---RTPAALRRGRKLVVQIGETFGEKNAPMFVEQLDALRLADKLALDLAPVMVYGDDVTHVVTEEGIANLLMCRDADE 473
gi 123626273 406 Y------GPQAIRGRKLVVQMVETFREHMAPVFVDDLDAWKLQASMGSDLPPIMIYGDDVSHIVTEEGIANLLLCRTPAE 479
gi 81792684  399 A-----RPGEMPRGRKLVVQMVETFREHMAPAFVDKLDAWELAERANLPLPPVMIYGDDVSHVLTEEGIANLLLCRTPEE 473
gi 489696861 397 Qvt-gDP--ALMRGRKLVVQIVETFGEGLVPAFVERLDALELAHKIGLELAPVMVYADDVTHIVTEEGIANLLLCRTADE 473
gi 500197767 396 RqqtsQEKKKMPRGQKLVVQIVETFREHMQPAFVEELDAWKVAEQAKLAIPPVMIYGDDVTHILTEEGIANLLLCRTEEE 475
gi 500095883 402 -----DKKSDVVKGRKLVVQMVETFQSGDTPTFVEKLDAVEVAHKTGMPIAPIMIYGDDVTHVLTEEGIAYLYMAEDLAE 476
gi 505248116 404 Rg-----dNPMPRGQKLVAQIVETFREHMEPAFVERLDAWDLAESAGMDLPPVMIYGEDLTHVITEEGIANLLLCRTREE 478
gi 524862880 404 Anr-yELMGDRNRGKKLVVQMITTVSEKGFPGFVEQLDAVALQKNANLDLEPIMIYSDDLTHIVSEVGIAYLHKCHNMEE 482
gi 501559511 406 Sr----dPYRMPRGRKLVVQLVQTFSDPTSPTFVERLDAWTLKDSFGLPLPPVMVYGDDLTHIVTEEGIANLLLCDDLAE 481
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 122477146 480 RMAAIRAVAGYTEVGIKEDPAETKKLREAKIFQTPEDIGIDRSRANRDLLAARSMRDLVDISGGLYNPPTRFRNW 554
gi 81379969  474 REHAIRGVAGYTEIGRGRDRRLVERLRERGVIRRPEDLGIDALDADRRLLAARSIKDLVHWSEGLYAPPARFRNW 548
gi 123626273 480 REQAIRGVAGFTPVGMARDKGTVENLRDRGIIRRPEDLGIDPRQASRDLLAARSIKDLVRCSGGLYAPPSRFRNW 554
gi 81792684  474 REQAIRGVSGYTTVGLGRDKRMVENLRDRGVIKRPDDLGIRPRDATRDLLAARTVKDLVRWSGGLYDPPKRFRNW 548
gi 489696861 474 REQAIRGVAGYTEIGRGRDRAMVERLRQRGIVRRPEDLGIEPLDADRSLLAARSIKDLVHWSGGLYEPPAKFRNW 548
gi 500197767 476 REQAIRGVAGYTPVGMARDKKMVENLRDRGIILRAEDMGIDKRMATRDLLAAKNMKDLVRASGGLYAPPKRFRNW 550
gi 500095883 477 RKLLIASVAGVTELGKQVSTEQVQLFREQGKVATPEDLGIRRSEANRSLLAAKNVSELVQWSEGLYQPPAKYRSW 551
gi 505248116 479 REQAIRGVAGYTPVGMARDRRAVENLRDRGIIRRPEDLGIDARLATRDLLAARNIKDLVHASGGLYDPPKKFRNW 553
gi 524862880 483 RMNAIRAVAGKTEVGKLEDPEITKKLRKEGIVKLPEDLGVNPAEATRDLLAAKNMKDLVDWSGGLYDPPAKFRNW 557
gi 501559511 482 REQAIRAVAGYTPVGLGRDRAVVTRLRAKGAVVYPEDIGVDKRLATRDLLAARSIKDLVRWSGGLYDPPARFRNW 556
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap