Conserved Protein Domain Family
OmpA_like

?
pfam16961: OmpA_like 
Putative OmpA-OmpF-like porin family
This is a family of putative OmpA-OmpF-like porins from Bacteroidetes.
Statistics
?
PSSM-Id: 319034
View PSSM: pfam16961
Aligned: 5 rows
Threshold Bit Score: 278.65
Threshold Setting Gi: 740773836
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81316246   59 YEVRALSTNWADKKLMVGFEGGWFFKDQWKLNLGGGVSFTNNPGYPAVPGTIDdsnKNNSADEnmGEIPNYRAVADAQSF 138
gi 524053591  57 YSTSALSTNWNDKTLAVGVEVGWFFVDLWRLNFGGGFNITQTPGYPPVNGTYD---ENSEPGD--GSIPSYEGVAAKTTM 131
gi 740773836  72 pyanmvSMDDNNATNMIGAEARYFLSDKIALKLSGLGVVRNTPSQVNIPATIDpdsPNST------WIPGYDAVVADDEL 145
gi 524518019  55 YSLPVKSTNWNDKDLRVGIEGGWFFLDEWKLVLGGGMSITKHPGYAAVPGTID---ENTSTDVndGSIPDYEAVADQNFL 131
gi 319416578  62 YEVSALSTDWSDKKLMVGFETGWFFKDLWKLNLGGGLNFTNNPGYSAVPGTIDa-gATSTPEDlmGEIPNYRAVADAYSF 140
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81316246  139 AYNVSAGVDRYFNIKrVPNLMWYTGIRVGFAYGENEMKYDEETS----------MGKSIAESWNLRGALTIGVDYFVLPA 208
gi 524053591 132 QYSAHLGVDRYFDIG-VEGLYPYVGIKGGFAYGFEAASMDDETW----------TGKSVSEAYNIRGALTFGTDYFITRA 200
gi 740773836 146 NFSIILGGEYHFTTP-IDRLQPYLGVNAAYYYGRESV-YDPTIEdiagepvimdVGIRTVELIGLGGAAVAGVDYYLMEG 223
gi 524518019 132 QFNVYTGVDRYFKTK-VDGLYLYAGARVGYAYGRNVSFTDDEYS----------LGKSVGEAFNIRGALTGGVEYYITDG 200
gi 319416578 141 SYNVFAGVDRYFKVKnVPNMMWYTGIRAGVSYGLNEMKYDEPEA----------MGKSTGETWNLRGAFTMGVDYFILPA 210
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 81316246  209 LYIGAQIDPFAYTYNKTTYNPQAGLGDLSADSHNYSVLAAPTFKIGFKF 257
gi 524053591 201 FFIGASVDVFAYTYNFTVIKPQEGLAGLAADSHNFSALAAPTIKIGFCF 249
gi 740773836 224 FYFGMEIKPVNYLYAYNAKKPGPGLEMLDAKSNTFSFFTQPFLKLGFKF 272
gi 524518019 201 LFVGAQVDPFAYTYSKNLVKPQEGLSNLDGNSHNYSILAAPTIKIGFKF 249
gi 319416578 211 FYVGAQIDPFCYTYNMTAYKPQEGLSRLDADSHNFSLLSAPTLKMGFKF 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap