Conserved Protein Domain Family
UPAR_LY6_2

?
pfam16975: UPAR_LY6_2 
Ly6/PLAUR domain-containing protein 6, Lypd6
UPAR_LY6_2 is a family of higher eukaryotic proteins expressed in neurons. It modulates nicotinic acetylcholine receptors by selectively increasing Ca2+-influx through this ion channel. The family carries an LU protein domain - about 80 amino acids long characterized by a conserved pattern of 10 cysteine residues. The family is a positive feedback regulator of Wnt/beta-catenin signalling, eg for patterning of the mesoderm and neuroectoderm in zebrafish gastrulation, where Lypd6 is GPI-anchored to the plasma-membrane and interacts with the Wnt receptor Frizzled8 and the co-receptor Lrp6.
Statistics
?
PSSM-Id: 319044
View PSSM: pfam16975
Aligned: 20 rows
Threshold Bit Score: 159.072
Threshold Setting Gi: 313229965
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82181137   41 TPYPGGFKCFTCEDAPDNYECNRWAPDLYCPRESRYCYTHHKMSWDGNTVSVTKRCVPLEDCLQTGCSDIDHEGNRVCTA 120
gi 557003580  41 TPYPGGFKCFTCENASDNYECNRWAPDVYCPRGTKYCYTQHRMDSNGMSISVTKQCMSLEGCMSTGCSETKLEGHKVCTS 120
gi 327281572  41 TPYPGGFKCFTCEQAVDNYECNQWAPDIYCPRVTRYCYTQHTLEANGKSVSVTKRCVPLEDCLATGCIDLQHKGLRVCTS 120
gi 902930978  41 TPFPHGFKCFTCEKAADNYECNRWAPDVYCPRGTRYCFSQHMMKVTGESVSVTKRCVPLEDCLSTGCTYVKHEEYKVCTS 120
gi 432850155  39 TPHPGGFKCFTCEDAPDNYQCNRWAPDVFCPKGTKYCYTLHMMDDNGSSVSVTKRCATLENCQLTGCVNVTRTGYQMCTS 118
gi 620978818  41 TPYPGGFKCFTCEKAADNYDCNRWAPDVYCPREARYCYTQHTMAASGNSVSVTKRCVALEDCLSTGCVDLEVEGHK---- 116
gi 533153421  41 TPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTS 120
gi 163915027  41 TPYPGGFKCFTCEKAADNYDCNRWAPDIFCPRETRYCYTQHIMNATGESVSVTKRCAALEHCLNSGCRDSINKDQKVCTS 120
gi 941805440  50 TPHPGGFKCFTCQDAADNYNCNRWAPDvycpkdTSYCYTLHMMDNHGDSVSVTKRCATLEHCRFAGCVNITHNGFQVCTS 129
gi 348506828  41 TPYPGGFKCFTCQDAVDNYDCNRWAPDVYCPKDTKYCSTLHMMDRSGESVSVTKRCATMEECLFTGCADVADTGYQVCSS 120
                         90       100
                 ....*....|....*....|....*...
gi 82181137  121 CCEGNICNLPLPRNETDAI---FSTTSP 145
gi 557003580 121 CCEGNICNLPLPWNASDAI---FATISP 145
gi 327281572 121 CCEGNICNLPLPRNASDAI---FATTTP 145
gi 902930978 121 CCEGSICNLPLPRNTTDAV---FTTLSP 145
gi 432850155 119 CCEGNICNIMVPRNDSSAI---FSSTSP 143
gi 620978818 117 ---GNICNC----DASQRVgrhFATTSP 137
gi 533153421 121 CCEGNICNLPLPRNETDAT---FATTSP 145
gi 163915027 121 CCEGNICNLPLPRNETDAI---FATTSP 145
gi 941805440 130 CCHGNICNVLVPRNDSGAV---FSSAGP 154
gi 348506828 121 CCEGNICNVLVPRNDSSAI---FSSISP 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap