Conserved Protein Domain Family
Grp7_allergen

?
pfam16984: Grp7_allergen 
Group 7 allergen
Statistics
?
PSSM-Id: 319052
View PSSM: pfam16984
Aligned: 3 rows
Threshold Bit Score: 257.837
Threshold Setting Gi: 158291791
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158291791  38 NMNNYIDVVMIQVGpwMNTHL---VPMALPDVVEGFEHRPiLITYHGELALTNGVFHTIHSVGRNGNAMMHYDRQLLRVA 114
gi 241622127  32 QTNDIFDQILDSVS--RSEEL---DPFQLAEMVSSFERKI-LFRLHGEARIYNGTITGLSTMHRAGDSHLKMDESNLEVL 105
gi 321473246  54 NANDYMDEVLTLVR--EQIVLqgyDRIALPDADFSFTWDE-YPGVTGGVYLHDGLATGMETIHRVGDATLSNSDTVIFFE 130
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158291791 115 VGANIRQLGFTYDYSAHIMDLGPTGFVDVDVATMTFTSEFIIDlT-DFYIWMQDFRLTNMGNLNIRFRGNILVDWMANIF 193
gi 241622127 106 ADVGVGALDVNCKAHVKFMGRGPTVNIAVHIAYARVLLEAFQP-Q-DGEMTLKQFKLQELNGFKLKMTGLGPLTYLFTYF 183
gi 321473246 131 SDCGINNAAFGYAISILFLDIGPTASMVGTADYINFYFHSTID-IlSGIVVVDVFDLKQMGHISTEITGLGIFNWLAEII 209
                        170       180
                 ....*....|....*....|....*...
gi 158291791 194 VNIITTVFRNTITNVVSNGIHDFIQATL 221
gi 241622127 184 VRVFTKLFKNKVKDIVESRLAKMVANKL 211
gi 321473246 210 VDFTLNLLAPFFKELLEGPITNLINTVL 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap