2WTO


Conserved Protein Domain Family
CzcE

?
pfam16986: CzcE 
Click on image for an interactive view with Cn3D
Heavy-metal resistance protein CzcE
CzcE is involved in heavy-metal resistance. It binds copper, which induces a conformational change.
Statistics
?
PSSM-Id: 319053
View PSSM: pfam16986
Aligned: 16 rows
Threshold Bit Score: 96.2782
Threshold Setting Gi: 500199447
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WTO_A        49 TLYGDPAGQSQASRIIDVKPGMRYVNVDSGETVAFRAGEKIVAWTFAQMv--RDTSVDLGLLMPDLPGSAGVRVYIDRSD 126
gi 75491909   71 SLFGSEAPAGSTSRVVDVAPGLKYVNVDSGETVTFKSGASEITFAFAQLd--RNKAVALNVLFPELPGGQGVWVYIEQSE 148
gi 262209134  53 RTFGRAGAESQVSRVVDTTRSTQYLNLVCGETVEFTNGKEQFIWKFDVM---GHRPVDLSKIAPAAFAGSTLKIYVAKNE 129
gi 501159223  28 KSYYGSEVQSPNFRTIDLSQK-KPININCGEIIQFSSNGKTFIWKADSI---YHSEVPIAKFAPKGFDAQGRSMFVAPNE 103
gi 500199447  28 DPLGNPAPAAAATRTIVITPETRWVNVEGGEVIRFIVGDKSFGWDFYVGs--TVTSFDLQLVAPPGVLNRRIVAYVSTDP 105
gi 501581941  53 ATYGY-ASNATPSRTVIVNADTRYINVTRLETVALKVGDKTVNWTFDTI---GTNSFPLSKVIQ---GGDKVTVYLEESP 125
gi 501404250  87 PLFGERATTAVGARTVVIAPGMKAVPVLAGETVRFDFGQSSAAWTFAARp--GSSAVELSMLFPEIPAAKGIWAYPNGTG 164
gi 93358748   51 TLYGDPAGQSQASRIIDVKPGMRYVNVDSGETVAFRAGEKIVAWTFAQMv--RDTSVDLGLLMPDLPGSAGVRVYIDRSD 128
gi 490773059  55 lLFGSPAPVSLAARTLTVKPGMKYINVESGETVAFSAGTGTQAWTFIEAm--QSTSVDLGVLLPDVPDAKGVRVIIARSK 132
gi 501404269  45 AQFGHPAAIAHASRTITLTPRIRYVHVYVGETVAFQIGEKKIGWMFTAPtigGGQPIDMSSIFPDIPEAKGIVIFIERSN 124

                 ..
2WTO_A       127 LF 128
gi 75491909  149 LY 150
gi 262209134 130 LE 131
gi 501159223 104 ye 105
gi 500199447 106 RY 107
gi 501581941 126 LY 127
gi 501404250 165 MY 166
gi 93358748  129 LF 130
gi 490773059 133 Wl 134
gi 501404269 125 LY 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap