Conserved Protein Domain Family
Asp4

?
pfam16996: Asp4 
Accessory secretory protein Sec Asp4
Asp4 and Asp5 are putative accessory components of the SecY2 channel of the SecA2-SecY2 mediated export system, but they are not present in all SecA2-SecY2 systems. This family of Asp4 is found in Firmicutes.
Statistics
?
PSSM-Id: 319060
View PSSM: pfam16996
Aligned: 2 rows
Threshold Bit Score: 94.6724
Threshold Setting Gi: 311096952
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 311096952  5 KKDLFYKEVEGRMESLKRRPAEKEKTTRSEKINVTFNVIIGLVILLGVIFTLFRV 59
gi 564713053  8 KKDLFYKEVEGRMESLKRRPAEKEKTTRSEKINVTFNVIIGLVILLGVIFTLFRV 62
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap