Conserved Protein Domain Family
DUF5088

?
pfam17008: DUF5088 
Domain of unknown function (DUF5088)
This is a family of microsporidial sequences of unknown function.
Statistics
?
PSSM-Id: 319071
View PSSM: pfam17008
Aligned: 6 rows
Threshold Bit Score: 243.513
Threshold Setting Gi: 169806674
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621766  186 GRVGYKTRMSSVTYTRKYpyYFLILLTSSRHLLKVFVWGEDL-PYSSMRVGDAIGLAKYREKPVIEGPPVVEH-NRFTEA 263
gi 667639083 163 AKIIQKTRISTYPTSFNP--FFFAIVSSGDVMVKIVFWIESLkQYSSLKVGDIIMVKEYRKKKKWSAFDKIDI-NTFTES 239
gi 378755314 218 GQVILKSRLFTFSSGGSLplFFSFILLTSAGLVKVYVWKLAVrKFFCIKEGDYIFIRGFKIKRRPGALLIADRtNTDSDT 297
gi 300708083 121 GKIIYKTRINVTNTSQ----YLFFILETDNELFKIIIWKENL-KYSSLNVGDFIGITKFRAGKGYPPQGHIEH-NEFSEM 194
gi 169806674 165 GQIQQKTRINLYPGVYNP--FFFIIVSYDIGIAKIVFWKENIlKYSSLDVGDTIYVKTFRKKKKTELCSKLTY-NTFTET 241
gi 672237319 218 GQVILKSRLFTFSSGGSLplFFSFILLTSAGLVKVYVWKLAVrKFFCIKEGDSIFIRGFKIKRRPGALLIADRtNTDSDT 297
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621766  264 RYFRCKEVSAK------EIFRIELEKYEEMPEpI--FTEAFGKVEYLSVLNRRS----AGYLEEYYLIRM----GRCRVL 327
gi 667639083 240 VYFDVEEITAK------ELVKIKFNKKSISRS-I--FETVEGKIEYLSVLMRYNc---NDTLMEYVLMHV----SGKKVV 303
gi 378755314 298 KYASIPEISVNlteptgHIMEMEMLHGLPKVPyDpeFTTVIGIVEYVSSLFRYRegkaRMKFREYVYLKV----SGIIIK 373
gi 300708083 195 GFFNVKELTVH------ELFKLPGLNTKETFKnIehFKNISGFIKYRSVLNRKS----NHGYSEYYLLMV----EDVKVV 260
gi 169806674 242 MYFDVDEIVSN------EIYKVSISLNKDIFR-I--FDTIQGHVIYSSVILKNNy---NGMYHEYQFLKLlhkdTIKYVV 309
gi 672237319 298 KYASIPEISVNlteptgHIMEMEMLHGLPKVPyDpeFTTVIGTVEYVSSLFRYRegkaRMKFREYVYLKV----SGIIIK 373
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|..
gi 74621766  328 LFYNSSKEFHEIEVGKYVRITNLRASKCRRSEFHISTIYTQI 369
gi 667639083 304 LFYNSDTEFYKINVGIHIVIAELRKMERAGFEFYVSTIYTQF 345
gi 378755314 374 LLANDTESIIDIKTGTSIEVRHLRKGTIGPFEFYISSLYTQF 415
gi 300708083 261 LFYNSDLNFYNIEAGNRIEITNLRQITRQNATFYISTIFTQF 302
gi 169806674 310 LFNNSQKEFYKLR-NKNIILYEMRYIKRGEINLYISTIYTRI 350
gi 672237319 374 LLANDTESIIDIKTGTSIEVRHLRKGTIGPFEFYISSLYTQF 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap