Conserved Protein Domain Family
zf-C2H2_aberr

?
pfam17017: zf-C2H2_aberr 
Aberrant zinc-finger
This is a family of largely microsporidia-specific proteins with an aberrant zinc-finger motif of Cx(4)C2H repeated.
Statistics
?
PSSM-Id: 319080
View PSSM: pfam17017
Aligned: 6 rows
Threshold Bit Score: 185.041
Threshold Setting Gi: 484853369
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 523779807  20 YKCFYKDCHLMYSTIYALRKHVVTYKHSNYFDNEvFSLKCPYRECcevyihnnffpnfE-------IKNLVFPHLKRKHS 92
gi 440491625  17 YKCLHNSCDLFYDSVLGLRRHISHYDHNLYYNPG-YSLKCPVRKCsvsi------vklD-------NVEFLYDHFEKEHA 82
gi 667633017  17 YKCLHSRCDLFYDSVLGLRRHISHYDHNLYYNAG-YSLKCPVRKC-------------DmsiceldNTDFLYSHFEKEHA 82
gi 484853369   3 YKCPFVNCNVKNSKTDFMDEHFREAEH--YTND--FELKCPIEKC-------------K-------NLNNCELHFEKRYA 58
gi 378755087  25 FKCPYSACGLQYQSSLGYKRHLMYYKHSIFTPSN-KKIVCGYMDC-------------T-------ATENLREHITREHM 83
gi 906371142  25 FKCPYIACGLQYQSSLGYKRHLMYYKHSIFTPSS-KKIVCGYMDC-------------T-------ATENLRDHITREHM 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 523779807  93 mvkediYNILEAVYECVIEYKNNGNKLKVKSRnkevVHKKEDVIINMEDMQNDNGVLKNIFSTIFFNSVIYIGDIRNK-- 170
gi 440491625  83 ------QRLAAQLRDILVRIKKTYETTKINYL----EHNVSDNCVNLSAVMRENDLLKDVLCSVYPSGVIKINDIDKP-- 150
gi 667633017  83 ------PRLVAQLKDTLVRIKKTYETTNINYL----ELNASDNCVNLSIVMRENDLLKDVMCFVYPNGVMKINDIDKP-- 150
gi 484853369  59 -------KFLRYVKFQEIAIENFNR----NYK----ESV-------FDDLITSRDTIATIIKTFIVNGKRGTYDSKNR-- 114
gi 378755087  84 ------ADAAELLEAYEIMIKVGEETEEVSTAgligDIVHDEGLLDISKVMTEDGIVKEILLSIFPKGVTHIIDMDTFse 157
gi 906371142  84 ------ADAVDLLEAYDIMIKVGEETEEVSTAgligDIVHDEGLLDISKVIAEGGILKDILLSIFPKGVTLIIDPETFte 157
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 523779807 171 --NLFYCRLNGCGKSFNSLTAYKYHCFNFYHSLKHIFLKY 208
gi 440491625 151 --DLIFCGIPGCGKHFKSVMAYKYHCQTYLHSFATLFDSY 188
gi 667633017 151 --DLIFCGIPGCGKHFKSVMAYKYHCQTYLHSFITLFDSY 188
gi 484853369 115 ----ISCPVIGCNKRYKQFPGYVYHTKNYKHPISEMISEY 150
gi 378755087 158 snQIFYCRIPGCGRQFKSLMAYKYHCGKFTHLFKSIIDDY 197
gi 906371142 158 snQIFYCRIPGCGRQFKSLMAYKYHCGKFTHFFKSIIDDY 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap