Conserved Protein Domain Family
Mei5_like

?
pfam17021: Mei5_like 
Putative double-strand recombination repair-like
This is a family of microsporidia-specific sequences with homology to the double-strand recombination repair protein family, Mei5 pfam10376.
Statistics
?
PSSM-Id: 319084
View PSSM: pfam17021
Aligned: 8 rows
Threshold Bit Score: 129.064
Threshold Setting Gi: 523776440
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621384     1 MYTATKPENAEE----YQELCVDG--RMFYKLGESKKKTVR-----------RRYSDQFK----NPLFIQKDVNRKLRMM 59
gi 484856027  102 MWLTEINEEDKDr---YEIFEVDD--KCFYKLKEEDVPKQKn----------RRYSDTFK----DPAFVQKTINRKLNLI 162
gi 667632133    1 MYFLNVKDNDKHl---YNALQVDG--ITFYSRKNNRSNQKKq----------RRYSDQFR----TNNLNYKDIYRKLKIL 61
gi 667638985    1 MFFTKIPENENIk--dYYEIKVDG--KIFYGPRQQSSEKNAgv--------kRRYSDQFK----DPLFTAKDTYRKLNMI 64
gi 906374412   32 AYFTERPALIEEm---RE---------GLQNIIEDPTIQKIn----------RRHSDQFRtietNRLSQEMDKNRKLRLI 89
gi 402471398   22 IFYKSVNTQNSNgdisLAALEVDNdnSAAVRLMAKTSMRKEcvykknslikkKRYSDQFK----DPLFIQKDTYRKLKMI 97
gi 523776440    1 MFYTSPPNNTNN----YHIKILNN--KKYYFLREKK----------------RRYSDQFK----DPLFIKKDIFKKLKMI 54
gi 1027189522  32 AYFTERPAL------------VEEmrEDLQKIIEDPAIQKIn----------RRHSDQFRtietNRLSQEMDKNRKLRLI 89
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 74621384    60 RQFREKHGDLEEEIERWKDCISECISILHSQHSVHPAEIFKAFPLGKWGFDIEEY 114
gi 484856027  163 KKFKNKNGDLPHLIERWKLLIEECIITMEKEYEIKPSELFQIFQLDKYGFNIDDY 217
gi 667632133   62 EKHKDDNKDLDDLTTKWKECIDKCINILKDVFELPAKEVFKAFHLEKYGFVLEDY 116
gi 667638985   65 KQFKIKYKDIGLITKRYIDCIENCICILEKEFSIVPRTVFQSFDLKQLGINPDDF 119
gi 906374412   90 HKFEKENKNISDVTDQWREVLLTAFEDLAKYTHAPRTDLYKAFHLKAIHVDKEEV 144
gi 402471398   98 EKFSTQDRNIESMIEKYKDSVSQCIFILKNEFNLPAKEVFTAFDLKKYGYTLEDF 152
gi 523776440   55 EKLYEENKNMEEEIEKWKECINNCIIMLIDSYDHNGKDIFKALNLKKYGFDIKDY 109
gi 1027189522  90 HKFEKENKNISDVTDQWREVLLTAFEDLAKYTHAPRTDLYKAFHFKAIHVDKEEV 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap