Conserved Protein Domain Family
DUF5098

?
pfam17023: DUF5098 
Domain of unknown function (DUF5098)
This is family of microsporidia-specific sequences with no known function. There is a very characteristic NPW sequence motif at the very C-terminus.
Statistics
?
PSSM-Id: 319086
View PSSM: pfam17023
Aligned: 6 rows
Threshold Bit Score: 473.142
Threshold Setting Gi: 378754839
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156   11 YKMLKCKCAYLKGYLEHVATVSKRSSDLLFRALQIPRDTAWN-DPLLTHCIEMNERQRAVFDETVLLYGEALFKELDGLI 89
gi 667631797  56 YKLAEEKVGWVLSFLDHVTTISRRTAELYFRCTQIPRNTRWQ-DVSIINIVEMMDKSRNSFDELTRMYEITVVVECKAIL 134
gi 402468461   4 LHVLKEKIEWIKAFLEHIELVSKRSGELLFRATQIPRKSSWK-DPFILELLEYSDKQRVIYDELSHLYTITIMNDVNELT 82
gi 523780466  11 FNTFRDKVQWIKMYVEHSDMVSKRATEIFFRSTQIPRDSKWR-DPIIIDLIEISDRHRELYDGLHRLYELTIGNDINNLL 89
gi 440493159  11 YKLAEEKVGWILSFLDHVTTISRRTAELYFRCTQIPRNTRWQ-DVSIINMVEMMDKSRNSFDELTRMYEITVVVECKAIL 89
gi 378754839   6 INILVNKAKHASAIYKQASAAQAAALQVFSESTVF-SNTAYSaDPLMISILKHCNLHLLTLKSMHKMA-CNVSRELDAAV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156   90 ATIVDDMRMIDEEVRAIAEKPAEGLKELRAARDRHVDAWTYGKHDPWLTELGLKRAVKKVLLMDDEANQMMHTKIGGFNM 169
gi 667631797 135 KKLQDKISELNGLEDRFNKALQKYLDDLMVCKQNHLEAWSSGIVDTWLTEKELRKALKKYLDENEAWNENLKKEVAVYDK 214
gi 402468461  83 SQINEEFAAINEEREKFDKNTKELYTVLEAKRNSYIEALKGNKDDPWLKLADLRSAFNKYYIEKNRSNELFRAQSFESEK 162
gi 523780466  90 KKLNERINLLKKHSTNREELLSVWLSTIKEKKDLHYVAWTENKLDPWYTEYDLKKTIKKYLKVDLDSNNELKEVVTQNDE 169
gi 440493159  90 KKLEDKINELNGLEDRFNKALQKYLDDLMVCRQNHLEAWSNGTADTWLTEKELKKALKKYLNENETWNENLKKEILVYDK 169
gi 378754839  84 KIAENYVAKTSEDMKNTENKLDNKMKSIYTAAETRKSAFTTEKYDIWKAEIELKEAIFSYIKEETSFHSLKKATISKSRE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156  170 SLQSATDRFREVLLSFVGIQKQKYQKLQ---DSVDTDIkrydeidRffd-----tvsESPKE-----------IRRECKK 230
gi 667631797 215 ELINISEKYHEIITTSLNIQRNHYKSLLmcgEEVLIDE-------Q-----------RFKKDcffdfpenedcSMNNREE 276
gi 402468461 163 NHDYYKKKYENIVKNFFKIQSSHFMNLS---STIDYDfen--------------klsELKDEiyydfpsqheeKSTESEN 225
gi 523780466 170 LLRELNINYKNIALNYIKIQKTHFSNIS---ESLDSNlfd--------------avtFSKSDifydfpdseacDLQSKDN 232
gi 440493159 170 ELHSISNKYREIIATSLNIQRNHYKSLLmcgEEVLIDE-------Q-----------RFKKDfffdfpenedcSIGNKEE 231
gi 378754839 164 VYNELLKSYYKSLQDFTSSSEAISNNFL---DEVSQDP-------FlkpallpdeflEISAEktnahdvlkgnIPQNIGE 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156  231 derlkeKVDASFETFVEGISKEL-SGRGITVRKNLEAVKSSVCKVKKgyTGDWTTAYMVVTSMGYAHFFDVSALVNES-- 307
gi 667631797 277 ------KNETKFEDAYEAIVNDM-RSRNPEITRDINVRKYGIFRVRR--NYDIKHALVIVTETQFVHAYDLDSIVLYLel 347
gi 402468461 226 eierfeKD---FKEILEQIYSSFgKKEDQISIKKPVIIKCGIYKQKKg-KNDWKPVFIVLSNKLFIHAFDMDVIMRKS-- 299
gi 523780466 233 kgedniNEEVIYNELVVSINEELkSLKKGFIKKKFRTKKYGFFNIKKhnGREYKPMFLILTENNFIHCYDISAK------ 306
gi 440493159 232 ------KSETKFEDAYEEIMNDM-RSRNSEITRDISVKKFGIFRVRR--NYDIKHALVIVTETQFIHAYDLDSITLYLel 302
gi 378754839 234 kqsltqDEQTRYNELHTQIVHSTyNHRSNFA---PAVHSCGLFLVPK--VSQDEILFIICTNTNYLHGFSFYSKLEEL-- 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156  308 -DSLRN----AIERLSAgaSRGLISMFDA-SKSTKEIGGDRIVFEVNAKVGEIIETFSS--PMVSIKLSDNTYELDKERR 379
gi 667631797 348 sDDQKA----LLKKLGD--YNRGISFFFG-RNEFLNTTEEKQLVFFSEHVFNHFNVSRGilKGFPITIKDKLIKLDKDKR 420
gi 402468461 300 -PNLRArfslLYKKLNDgsYKKFISFFDKpKSRGLNFNEELELKELSTAIISETDLISYhlPNISMNLNHWIVKLDKEKF 378
gi 523780466 307 ---PFD----LTTKLLKisQKTSPSFFDNsKIVNLTQQDEKELKNITEIFMKEIDFTCNviKGFPIQTTEKLIKLHKEKS 379
gi 440493159 303 sDEHKA----LLKKLND--YNRGISFFFG-KNEFLNTTEEKQLATFSGYIFNNLNVSRGmlKGFPMTIKDKLIKLDKDKK 375
gi 378754839 307 -SHLLP---------------EEKEGFVPsLRHALINFNEKQIERIHAYLLNSIGCLKTvsKVFPISLKNKTVYLQGDK- 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622156  380 QVSVNSKHQNGFASFFGVSEVKVKLFTLSNAIEIFHALRSKNQVEESTEDFSESSEKETDgGRVFRVlLQE-------EE 452
gi 667631797 421 ELIITGRKSPMLKNLFVSNTIKIKSFVLRDAYELFFSFCKTAEKKGVEVKEEENDETMPD-GSKIIS-YKE-------DE 491
gi 402468461 379 EMIFSEKRVNTFTSIFINNTLRIKSFALKDLYELYFGIFDHNKILIDNSNIEISDCNVVAnESVEKEkEEN-------IE 451
gi 523780466 380 EINITSKKSNNMLNIFWDSSIKIKGYTLKDIYELYFAILNENKTEEKEKKFLLNNQQEKDtDTTDKGaTMEkisenilGE 459
gi 440493159 376 ELIITARKSPMLKNFFVSNTVKIKSFVLRDAYELFFSFCKTVEKKGSSDAKDIETTEVVPsDSKIIN-YKE-------DE 447
gi 378754839 370 EIVIKEES-------FFPRIIKIQAFHSQQIQKFSWFLSDPSINAECTTEEAPIDQEQETaWS-----PIP-------YD 430

                 ...
gi 74622156  453 NPW 455
gi 667631797 492 NPW 494
gi 402468461 452 VPk 454
gi 523780466 460 NPW 462
gi 440493159 448 NPW 450
gi 378754839 431 NPW 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap