Conserved Protein Domain Family
CBP_BcsS

?
pfam17036: CBP_BcsS 
Cellulose biosynthesis protein BcsS
This is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).
Statistics
?
PSSM-Id: 319098
View PSSM: pfam17036
Aligned: 20 rows
Threshold Bit Score: 127.801
Threshold Setting Gi: 753803253
Created: 19-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123773207   98 NIFRASAL---PGWRIKRGDLEVRVFAGPTIEIRGFKPAVQIDKLSGSRFGVQLASELWWEPTPAMMVAAAAAVTTINSV 174
gi 1139449858  99 QQADLAAM---AGYALVGPDSVLSGFVGLAVRRDEVAQSGLTETVARTGVGLKTALDYYARPTAFTMFHATGTYSTAFNA 175
gi 1175169716  96 dagifDLM---IGYQFIRPSHRLGVYAGVEFQGHELSPDDPFNDIDGNEWGLKIVGDYETATGSPLYVGLIASYSTAFDT 172
gi 501370190   94 VKVHGEALdgaLGLQTAWQQGWFQASAGVHFRNNRVSPDGADAKADGSQFGLSLGVQGEERFGNDWSFGGIGVYTVGPAS 173
gi 503714374  322 DDRSLDVM---LGYQWVFPTWSAIGYVGYEVRSVHLSPFDPNNNVVGGESGFKVAGELETDDSLPYYASLEGSYSTAFDS 398
gi 503186235   91 KEWQGDVM---LGYQLVYTTFSAGLYLGVDFRDDHLSPRDLSNSVRGNEVGFKVDADFETETELPYYFGADGYYSTAFYS 167
gi 984665577  124 YQQEGSLL---TGYEWIWREAALAGYVGFNVRSNQLSIPDPGNPVVGTGVGLKVAGNFYATPTDRTMVSAYGSYSTKFNA 200
gi 1140875519 121 YQQEGALQ---AGYEWVWKDAALAGFIGFNVRSNQLSIPDPGNPVVGTGVGLKVAGNFYATPTDRTMISAYGSYSTKFNA 197
gi 168192746  102 VQAEGSAL---LGYEWIWQQAAVAGYIGFNVRHNELSIPDPRNPVVGTGVGAKVAADIYLNPTVDTLFAANASYSTLFRA 178
gi 489693988  103 FTALGAAL---GGYQFIREWGAVTVFAGPEASWEALS-GPGFVQALPLRAGFRLHGEVWARPTETTLMTATVILGSARGD 178
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123773207  175 YSARAAAGWRL-------FDRFWIGPEVSMSTDRF-STQYRLGAH----VTg---FRTG--VLEWSAGVGLVQ-DSFDRN 236
gi 1139449858 176 YYGRVRFGIAA-------LAGGYVGPEFAALGDDY-YRQWRVGAH----LSg---MQIG--AVQLGLSAGYVH-DHVRKG 237
gi 1175169716 173 YWTRARVGTPV--------GRFVLGVEGLAHGNNG-YDAQRLGGF----VNipvgMHYG--I--LSLSGGYQWadedssa 235
gi 501370190  174 YWTRVRLLHRA-------FGTAWAGVEFSRHGDPN-YHTNQGGLV----LTg---IRIGt-GLDLGFYTGVKK-TTGQSR 236
gi 503714374  399 YYGQARVGWNRems-ffgPRTITFGPEAAVYGDGG-DYAPRVGAF----ATipfqMWWLntPAKLTFDVGQQW-TGGSDG 471
gi 503186235  168 YLARGRVGVKVieeldanFKQIFVGAEGYALGNEE-SDAQRAGGFlkfeLSn---LLVR--TASITLSGGYQF-VNGNDN 240
gi 984665577  201 YYSRFRVGYMV-------ADGVYIGPEALFLGDDF-FRQYRVGAH----LSg---LSFG--PVQMSLAAGYVR-DRVQGT 262
gi 1140875519 198 YYSRLRVGYML-------ADGVYIGPEALFLGDDF-FRQYRIGAH----LTg---VRFG--PVQMSVAAGYVR-DRVQGS 259
gi 168192746  179 YYARLRAGFAV-------ADGVFLGPEGTFLGDQF-FNQWRVGAH----LTg---FFVG--PMKFSLGAGYVF-DRIQKS 240
gi 489693988  179 AYARLSWGTAL--------FGAYLGPEAAFYGDQTdYRKWSVGLH----VTd---YAMG--GYRFRLSAGGQLeTRLNQW 241

                  ....*.
gi 123773207  237 GVYGRI 242
gi 1139449858 238 GLYTAL 243
gi 1175169716 236 ssggss 241
gi 501370190  237 SFYGGV 242
gi 503714374  472 GETRAg 477
gi 503186235  241 gtgtts 246
gi 984665577  263 GYYSSI 268
gi 1140875519 260 GYYSSI 265
gi 168192746  241 GYYTSV 246
gi 489693988  242 NPYVSL 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap