Conserved Protein Domain Family
BPTA

?
pfam17044: BPTA 
Borrelial persistence in ticks protein A
BPTA is a family of proteins that are found in Borrelia species. The function is not known.
Statistics
?
PSSM-Id: 319104
View PSSM: pfam17044
Aligned: 2 rows
Threshold Bit Score: 225.267
Threshold Setting Gi: 327507687
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 327507687  16 LGFFFYKQKEnnvIYNKiVEKFDDN-VFVDETYTYLFKDSNLKELVFIKSQLIIPElkhkKMIK-ATGYRADAYKALSTV 93
gi 81556078   31 IGIFYSNNFK---EERN-YSISPIDsVIMRKCYFKEFKSGLIKSVFFKKLDVNVNS----KNFKeLNKVDKQNLLNSYPS 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 327507687  94 YRFDFKVHDN-KILGFKSVIFEGFEDAKVSKHE-NNLPSEKWQQLKDFN-IGDPNINEKFFHLEFPFVVKNTLCVTISKG 170
gi 81556078  103 YHMEFVVVDNgFLMNFKNVIFNGIDDAKLYDQRdMVYGGFRYSKEAYFQiIGNYDVKLNKMKQYTPAIVVNVFKININDA 182
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 327507687 171 FFKKIKKLKRLKIMLISNEDREYKIDIENFLPKYNL 206
gi 81556078  183 LFNSLLKQKTLKVTLISHNNKEYILQTNNFLSKYNF 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap