Conserved Protein Domain Family
CEP63

?
pfam17045: CEP63 
Centrosomal protein of 63 kDa
CEP63 is a family of eukaryotic proteins involved in centriole activity.
Statistics
?
PSSM-Id: 319105
View PSSM: pfam17045
Aligned: 9 rows
Threshold Bit Score: 242.013
Threshold Setting Gi: 257096328
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096263  19 LTSCEAELQELMKQIDIMVAHKKAEWEGQTQALEACLGVREQELSSARAALEEKHKEVGKLRQQLEDMEAAKQDLVREYE 98
gi 257096327  18 LTSCEAELQELMKQIDIMVAHKKSEWEGQTHALETCLDIRDRELKALRSQLDMKHKEVGILHQQIEEHEKTKQEMAMEYK 97
gi 257096328  17 LSSCEPELQELMRQIDIMMGHKRHEWEAEVRAMELSLHNTQEELQSAKALLDKRNSEIRVLGKQLEELHTGKQELVVKYE 96
gi 780028517  18 LSSCQGELQELMRQIDIMVNNKRLEWEASIKASEAQVRQRDEEIITIKMALDAKTSETNRLTHESVGMERTQKELVTQYE 97
gi 327267239  18 LTSCEAELQELMKQIDIMVAHKKAEWESQTQALESFLDIREQELSAVRNTLEEKHKEIERLCQRLEGIEQLNHDITVEYE 97
gi 973185957  43 LSSCEPELQELMRQIDIMVAHKRSEWESQHRALQGRLQVREEELRSARDALEHKHKEVGMFRQQLLEAQNEKQELVSKYE 122
gi 551505981  17 LSSCEPELQELMKQIDIMISHQRREWQVEKHFLEVRVKNGEEGLLTSKNIIERRDLEIGVLQKQLEEILRSRQEAVAKYE 96
gi 908531586  17 LSSCEPELQELMRQIDIMINDQKRKWEDETCALELRLKSREEELLNSRSTIERRELEIGLLRKQLEDVQTGRQELAAKYE 96
gi 332207907  11 TSPCEAELQELMEQIAIMVSNKEMDWERKVRALETRLDLRDQELANAQTCLDQKGQEVGLLRQKLDSLEKCNLAMTQNYE 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096263  99 QQLKKFQEELARLRRSYEKLQKKQLREA------Re---eATKRQGDDQCEMSRLSRKLEEFRQKSLDWEKQRLLYQQQV 169
gi 257096327  98 EELLKLQEELSRLKRSYEKLQKKQLREF------Rg----NTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIYQQQV 167
gi 257096328  97 EQLLHVKEELSKLKRSYEKLQRKHLKES------Rd----GALSREEDRTELSRLNSKIEEFRQRSAEWEQQRLQYQRQV 166
gi 780028517  98 QQVDQLRRELVALQKSYEKLQRHHGKQNdgvekvKe---eSEVKLRKARVDLRMAESKIEDFESQAHEWDVQRRAYKKQV 174
gi 327267239  98 QELSKVQEELARLKRSYEKLLKKQLKEA------Rq----TSKSQENDQSDVSMLTKKLEEFRQKSLDWETQRLHYQQHV 167
gi 973185957 123 EQLQRVQEELSKLKRSYEKLQRRQLKEA------Re----gARSREEDRTELSRLNGKIEEFRQKSAEWEQQRLQYQRQV 192
gi 551505981  97 QQLQKLREELDLLKGSYQKLQRKQLKQT---------------------SGGAKESDQLKEYQRLSAEWEQQRAQYQKQL 155
gi 908531586  97 QQLHKLREELDKLKRSYHKLQRKHLKDA------Na---gV------------KETDLQKEYHQRSLEWEQHRTQSQQEL 155
gi 332207907  91 GQLQSLKAQFSKLTNNFEKLRLHQMKQN------KvpreeLPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQTHL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096263 170 ASLEAQRKALAEQSELIQT-------Q--LASRKQILESVELASRSEIQHLTSKLERANDTICANELEVERLNMRVDDLT 240
gi 257096327 168 SSLEAQRKALAEQSEIIQA-------Q--LANRKQKLESVELSSQSEIQHLNSKLERAKDTICANELEIERLNIRVNDLM 238
gi 257096328 167 SLLEEQRKTLAEQFSLIQS-------Q--GVGRPQE------QGQGELQRLRSQLQRAQDSLHAQELELERLRLLQDELG 231
gi 780028517 175 EGLEAQRQKLAEKCQVCQQdaaaykhQ--LAKRQQTLDQNDLDFRARLVHIEAQLQRAQDTLDGKNTAIQRLEELLEEAG 252
gi 327267239 168 ASLEAQRKALAEQSELFQt-------Q--LSSRKEMLESVELASKSEIHHLTSKLEIANDTICANELEMKRLNMRVDDLT 238
gi 973185957 193 AALEAQRKTLAEQYQLMQEsaa-yhsQ--VSGRQQ--EQSELAIQSEVQRLRSQLERAQDRLHAQEMELERFSLLWEELG 267
gi 551505981 156 TTLEAENKSLTEEISHIKSapw--rvE--QEHMECC---------SEVQHLGALLEKARSSLLSQEMELERLRPCEALLG 222
gi 908531586 156 TALEAENKSLKDELSHIKSqwa--ahQveREHRDCCL---------EVQRLRSQLEKAQRSLHTQELELERLRPLESWQV 224
gi 332207907 165 ISLDAQQKLLSEKCNQFQKqaqsyqtQ--LNGKKQCLE----DSSSEIPRLICDPDSNCEINERDEFIIEKLKSAVSEIA 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 257096263 241 ENNR---MILEDQQRVAEE---L-------RQSKKMLEVLQDEKMELRATLQSQE 282
gi 257096327 239 GTNM---TILQDHRQKEEK---L-------RESEKLLEALQEEQKELKASLQSQE 280
gi 257096328 232 DSI---------KEQQVSC---H-------AAAHRRGQVLSEEREELKATLDAQD 267
gi 780028517 253 KRKR---MVEDENHQLLED---V-------GRKEHQRQMMESEVSSLQQQLESKE 294
gi 327267239 239 DKNK---KILEEQQRLTEE---L-------KISQHSLEVLHNEKMELRATVLSQE 280
gi 973185957 268 DSRRelqVLSEEKTELKAT---LntqdefvRSSGLQQKQLRAELGRLSEALQAKE 319
gi 551505981 223 ASQ-----PQQLRSDEPDA---S-------RGPDQDQQRRGNEAVRLRQLLHAKD 262
gi 908531586 225 --------LSEEWEELDSQdafV-------RRASLERQRLRNETARFNQALQAKD 264
gi 332207907 239 LSRN---KLQDENQKLLQE---L-------KMYQRQCQAMEAGLSEVKSELQSRD 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap