Conserved Protein Domain Family
Osw5

?
pfam17062: Osw5 
Outer spore wall 5
In fungi the outermost cape of the spore wall is made up of a polymer that contains cross-linked amino acid dityrosine, which is important for the stress resistance of the spore. The OSW family of proteins have been implicated in assembly of this protective dityrosine coat. OSW5 null mutant spores show an enhanced spore wall permeability and vulnerability to beta glucanase digestion. The proteins are predicted to be integral membrane proteins.
Statistics
?
PSSM-Id: 319113
View PSSM: pfam17062
Aligned: 12 rows
Threshold Bit Score: 75.8064
Threshold Setting Gi: 403215963
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325530190   6 SVYFLIYFVSFLAIAAVASFFIIPLLGISFLFASAVVVFGFLSDITFKFAQSLYIKTDHRLKSTLSKMGN 75
gi 325530184   6 IFIALLYLGGFLIILVTASAVILPLLITSLFFATGVVLCGFLSNKSYKLALRAYNLATPHTRSSLQAAAD 75
gi 74605304    7 P-QFAFHLVTFLSIAFIASIFVLPFLTFSFVLSSATVGLSFASRTSFEIGLFFYDRFVILLQGQLRGMID 75
gi 325530185   7 TVYFFIYLLLFVSIGLTSSLFIVPLLGASFAFASGVVIFGFLSNVTFKSAQTIYIKVDKRLKFILAKMSS 76
gi 365989782   6 SVYFFIYLVIFLIIATASSIFIIPLLGTSFIFAVGVVTFGFISNVTFKLAQNLYFSADERLKSTLKKMSK 75
gi 254577465   6 SVYFLIYFVSFLAIAAVASFFIIPLLGISFLFASAVVVFGFLSDITFKFAQSLYIKTDHRLKSTLSKMGN 75
gi 410076700   6 TFYFLTYFIIFMSIGFIASLLILPLLGISFLFATGVVVFGFVSNLTFKMGQYIYFKTDRNLKKILDRMAL 75
gi 367003473   7 ILYFIIYLVLFILVTFMSALFMFPFLGASLFFAVGVIVFAFLSDLTYKIAYLLYIKFDKKLRFFLEKMSI 76
gi 444317186   6 TIYFLIYLSIFIFIGLTSSIFIVPLLITSFVFATLVVIFGFISNSTLNLALWLFFKTNMYMRKTINKRRI 75
gi 403215963   3 LLGIIVYAAAFFALTIASSLLIIPLLVMSFIFATLVIVFGFISNATFKMCQAIIFRVEGILHGIYFHMIT 72
gi 325530189   6 TFFFFVYLTLFVVIGFFSSLFIIPLLGISFVFAIGVVSFGFCSNMSFKMAQLIYVRADAFLKKVLDKMAL 75
gi 754403157   9 TISFAFFGAVFMGVSAAASVFILPLLALSFIFSGLVVVFSGLSYTTFKMASSKYNRTVLLLNKLLRKLAD 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap