Conserved Protein Domain Family
BRD4_CDT

?
pfam17105: BRD4_CDT 
C-terminal domain of bromodomain protein 4
BRD4_CDT is the short highly conserved C-terminal domain of certain bromodomain proteins, notably Brd4. The Brd4 CTD interacts with the cyclin T1 and Cdk9 subunits of positive transcription elongation factor b (pTEFb) complex. Brd4 displaces negative regulators, the HEXIM1 and 7SKsnRNA complex, from pTEFb, thereby transforming it into an active form that can phosphorylate RNA pol II.
Statistics
?
PSSM-Id: 319127
View PSSM: pfam17105
Aligned: 20 rows
Threshold Bit Score: 45.0369
Threshold Setting Gi: 658846978
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 426020769  890 GITEEERNLARMREQERRRREAMAGTIDMYLQSDIMATFEEHLC 933
gi 954609302 1176 TQGMSQREIARMREQERRRKEAMENQVDIMMQMELMAGFEQEIR 1219
gi 761914441 1008 NSPVDEVERERLKEKQRQEREKMKQQIDMTYQNDLMSQFEMTMY 1051
gi 597779833  943 SSVDREREMARKREQERRRREAMSGIIDMTMQSDIMATFEKNLD 986
gi 847171619 1320 QPIMDQREMARKREQERRRRQAMAPSIDMNFQSELMEIFEQNLF 1363
gi 962014760 1380 saldqqrdrerlrerdrrfreAMADNIDINFQSDLMAIFEESLF 1423
gi 584019447 1399 NTLNQDRATARREAQERRRREAMADTIDINFQSDLMAIFEENLF 1442
gi 658830675 1430 SALDQQRDRERLRERDRRFREAMADNIDINFQSDLMAIFEESLF 1473
gi 195060212  676 DRAAAKRAEQRRAEQERRRREAMAGQIDMNMQSDLMAAFEETLS 719
gi 985398130 1182 DRAAEGRERQRLREQERRRREAMVNQIDMNRQSDLMAAFEQTLA 1225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap