5CD6


Conserved Protein Domain Family
DUF5107

?
pfam17128: DUF5107 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5107)
This family is found in range of different bacterial species. In many proteins it lies N-terminal to a TPR-repeat region at the C-terminus.
Statistics
?
PSSM-Id: 319147
View PSSM: pfam17128
Aligned: 5 rows
Threshold Bit Score: 441.236
Threshold Setting Gi: 906849270
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5CD6_B         30 LDPNGVYPYXSYSETSNRPVPKRYRXISLENEKVKAIICPDLCGKVISLTHKESGKEVLYRPDVIKYTRILPRFYFVAGG 109
gi 123319294   50 GAEQPWYPYPVRSSLGKQSRAETWRTLNLENEFLACIVLPDLGGHLYSCRDKLSGYEMFHANPSIKKAMIGLRGAWAALG 129
gi 503785090   48 ayrpnIYPYFNFEGYSTKPEKIKWDLITMENDYLKITVMPQIGGRIWGAIEKSTGEDFIYENEVVKFRNIAMRGPWTSGG 127
gi 506291433   47 KKVAPFYPYNVFDGYTNKSTTQNWKIVELENPYIKVQVLPEVGGKVMGAVEKSTGEEFVYTNHVMKFRAIGIRGPWTSGG 126
gi 524425429   56 MDADGVYPYISYSETSNRPIPKTYRMISLENEFVKVVICPDLCGKVMSMIHKGSGKEVLYNPHLVRHTRILPRFYFVAGG 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5CD6_B        110 IEVSFP--ISHSPTQNEPVLYQIDHTGD-RTYVTCGERESHYGXQWSVEYSLGDKDECLTQRVVYYNPGKQAYPWXSWSN 186
gi 123319294  130 VELNFP--VGHSLLTVSPVDFRTTQTAD-SASVWVGATDRVTGMRWRVEFTLERGAAVLRQSVRLENATPVRQRYYWWTN 206
gi 503785090  128 IEFNFGi-IGHSPATASPVDYMYYENEDgSITCVVGTIDLPSRTQWRVKINLPKDKAFFETEGIWYNPEPLRQPYYNWMT 206
gi 506291433  127 IEHNFGldLGHAPWAAAPVDYVMQTNADgSVTCTVGGLDLASRTQWRVKIVLPKDKAYFETQSLWYNPLPLHDAYLSWEN 206
gi 524425429  136 IEVSFP--ISHTPTQNEAVCYKIDRTAD-RVYVTCGEREIRYGMQFSVEYSLGTGDHFLTQRVRMHNPGTNAYPWMSWTN 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5CD6_B        187 AALPCAPDTQYDFPNGTvlshastldtidwktEGThheRDIKE----XTG---YFWKTKDV-------------NAFGAY 246
gi 123319294  207 AGVTLTDDTRFVLPTKE---------------IAShgkTQIDTwpvgKSGldrSNPANFPTsagwfa--hesrePFVAVY 269
gi 503785090  207 AAAHVANDQEFYYPGHIa-------------lQHS---GEVKDwpiqD-GiaiNHYKNNNFggaksqhiagsflNHFGGY 269
gi 506291433  207 AAFRASDDMQFFFPGTHh-------------vGHD---GNASPwpldEKGvdlSYYKNNNSggdksyhvvgthtEWFGGY 270
gi 524425429  213 AAIPCMPDTEYSFPQGEvlvhasaldtinwkkKGPkkeKDISE----MTG---YFWKTKDV-------------NAFGAY 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5CD6_B        247 TPSLGSGLYHIADESSTPGIKLWSYGVAG-DKewS--XLsTPDRQPYVEIQGGPiSDQSIKLE---------L------- 307
gi 123319294  270 HPRAQTGTLHYADPAEVAGKKIWAWGRDEdRQ--VraML-SDDNSQYVEIQAGL-FANQETFG---------Fl------ 330
gi 503785090  270 FHNKGIGFGHFSTYDDSPGKKLWLWALSRnGGiwEd-LL-TDNDGQYMEFQAGRmLNQFSPSKsvetpltkaGf------ 341
gi 506291433  271 WHDRKFGFGHWAPYSDAPGKKLWIWSRAReGAiwEd-LL-TDKDGQYIEAQSGVtLNQAAERS---------Gfhspfnq 339
gi 524425429  273 TPSLGYGLYHIAEEQSAPGIKLWSYGVKE-DKewS--LLsTNNRQTYAELQGGPiSDQSIKLE---------L------- 333
                         330
                  ....*....|....*...
5CD6_B        308 ---RPGEKKNHVEYWIPT 322
gi 123319294  331 ---EPGASRAFTEYWIPV 345
gi 503785090  342 ---APYTLDQWSNYWFPV 356
gi 506291433  340 kslGPYYSETKTEYWFPV 357
gi 524425429  334 ---QPGEYREHTEFWIPA 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap