4Q6M


Conserved Protein Domain Family
Peptidase_M99_C

?
pfam17129: Peptidase_M99_C 
C-terminal domain of metallo-carboxypeptidase
C-terminal immunoglobulin-like domain of helical cell shape-determining peptidoglycan hydrolases, a metallo-carboxypeptidase. The structural elements of this domain form a Ca2+ binding-channel, the Ca2+ being co-ordinated by six ligand-atoms.
Statistics
?
PSSM-Id: 319148
View PSSM: pfam17129
Aligned: 2 rows
Threshold Bit Score: 180.499
Threshold Setting Gi: 704360629
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4Q6M_A       340 FDPSLEEVKMQIDNKDQMVKIGSVVEVKESFYIHAMDNIRANVIGFSVSNE--NKPNEAGYTIKFKDFQKRFSLDKQERI 417
gi 502787736 301 FDNSLQTLKIQVDGKTKEVKIGSIIPVKQNFEILDLPGYRANIIGFVSPKDrsDKPNEMGILISKKECAPRFSIDKKGKI 380
                         90       100
                 ....*....|....*....|
4Q6M_A       418 YRIEFYKNNAFSGMILVKFV 437
gi 502787736 381 YRAEFYKGDAFSGMLLFRFQ 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap