Conserved Protein Domain Family
Glyco_hydro_106

?
pfam17132: Glyco_hydro_106 
alpha-L-rhamnosidase
Statistics
?
PSSM-Id: 319151
View PSSM: pfam17132
Aligned: 20 rows
Threshold Bit Score: 1091.99
Threshold Setting Gi: 361059282
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516   45 QDPPMEARPRVWWHWMNGNITKDGIAKDLAWMKRVGIGGLQNFDAGLDtpQvvDKRLVYMTPEWKDAFRFAAIEADRLGL 124
gi 283815469   32 LNPPASARAQCWWHWMNGNVTADGITRDLEAMKQIGLGGFQNFDAGTGipKg---PVVYLSPEWLALKEHTIKEAERLGL 108
gi 506289997   42 KVTPDTIQTSVYWYWMSDNISKEGVVRDLKAMKTAGINRA--FIGNIGynStpYGKVKLFSKQWWDILHLALKTAGELGI 119
gi 503429095   41 QQPPDSIQTSVYWYWISDHISKEGVVKDLEAMKAVGINRA--FIGNIGleDvpYGKVKLFSDEWWEITHAALKRAGELGI 118
gi 361059282   26 LSPPESTKPWVYWYWDNDNISKEGITKDLEAMAQVGIGEA--LIGNIVggAssKGKVTVLSEDWWSCMVHAITEAKRLGM 103
gi 177841308   39 RNPPDSAKPRTWWHWTMSNVTKDGITKDLEWMKRVGLGGFQLADVNVGrgQevEPKTPYGTPAWYDAVRHAAAEADRLGL 118
gi 503603010   47 KDPPSSARPRVWWHWMNGNITKDGIRKDLEWMKRVGIGGLQNFDANLQtpQivDHRLVYMTPEWKDAFRFAAHEADRLDL 126
gi 506376227   41 STPPESARPRVWWHWMNGNISRQGIRLDLQWMHSIGLGGVTTIDASLStpQvvKQRVVYMTPAWRSDFLYATRLLEQFDM 120
gi 524576385   24 QHPGQPYRPRVWWHWMNGNITKDGIYKDLTWMKCSGIGGFHVFDAGLStpQvvEKRLPYMTPEWKDAFHYAIHLADSLGL 103
gi 524597049   48 QNPPKSARPRVWWHWMNGNITKDGIKKDLLWMQKTGIVGFHNFDAGLEtpQivDKRLIYMTPEWKDAFKYAINLADSLDM 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  125 ELAIAASPGWSETGGPWVKAEDGLKKVVWSETVLKG-GKRFSGKLPLPPAETGPFLD----MPESDpLAAivgdHGFKaP 199
gi 283815469  109 EFTMHNCPGWSSSGGPWITPELAMQQVTWSETVITG-GQAVSIPLAQPLTNLNYYRD----VAVI------------AyP 171
gi 506289997  120 EIGIFNSPGWSQSGGPWIRPEQSMRYLTSSETLIKG-GGRVNVLLEKPKP---QFQD----VRVVa-FRa---------P 181
gi 503429095  119 EIGLFNSPGWSQSGGPWVKPAQAMRYLGATETLVRG-GKQVAVKLPQLGE---NFQD----VRVLa-FPAs--------a 181
gi 361059282  104 KIGVFNCPGWSQSGGPWVKPEQTMRYLVSTELQVTG-GQSFAYAFKPPTE---NFQL----VSVQa-FPV---------P 165
gi 177841308  119 EMSIFSSPGWSETGGPWVKPEQAMKKLVWSETVVDG-GKRFSGKLASPPNAIGQIRD----SGASY-YTs----D-STsA 187
gi 503603010  127 ELAIAASPGWSETGGPWVKPQDGLKKLVWSETTLAG-GQRFVGRLASPPGTTGPFQTlhppVTIEEiISGv--pAETGgV 203
gi 506376227  121 KESIDSSPGWSETGGPWVRPSQGMKKYVWSTIVVQG-GRRFDQKLPHPPSETGAFQD----ETIHDvLGSs--sGDRTiP 193
gi 524576385  104 EATIASAPGWSETGGPWVKDEDGMKKLVWRQTEVKGtGKDLKVKLPGGFDITGPYQD----YCYVNqS-Va---TVFLqK 175
gi 524597049  128 EMTIASSPGWSETGGPWVKDEDAMKKLVWRQVEIKG-GQPVSLKLPEGFDITGPFMD----FTGS--FDGv--sQVFLrK 198
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  200 ALYSDVAVLAVPDLG----Kplpvp----aysagGKSLD----AAALSDGSLKTGVTLARGPVDAPTTIVAAYGAPQTVR 267
gi 283815469  172 SLPGEVSL---PTVV----Qqis--------angGGVVS----ADELAGS---KGVSIVGDADDKPVTLLIEFKQPYEAH 229
gi 506289997  182 EAYGSTLT---DLRPvlt--------------skPELPQ----LQNLIDRDTSTAITITD---ANQVNIDFQTEREYTAR 237
gi 503429095  182 EYGQSIAD---A-SP----Eila----------qpSLKN----LPLLIDQDTQTHVKLPA---GLATAITFTTDKDYSAR 236
gi 361059282  166 AEDNDG--VSTKspvv---------------sskG-MNN----AQWLFDGDPNTEVVVPAT----EQQLEIKLNSVATVR 219
gi 177841308  188 PFYADAAVVAYRVPAaeprMadlhpr---vstheG-EID----GTALLDDKLATLLTVKA-PEGGAAWVQFEFAEPFTAR 258
gi 503603010  204 SYAGEVGVLAFPVPD----Iaslpvp--raldgaGNVLA----GKALVDADIAGGVTLARVDGKAP-LLRLDYQRPVTVR 272
gi 506376227  194 HYYEDSVVVAYRIPA----DdvplaslhpqitasGGHPD----YALLTDGNLTRTTSLAIPPQGQDAWIRYAFSHPVTIR 265
gi 524576385  176 KFYRDVAVLAMRIPD----NdksmmelnptittsGGTVT----AEQLGNDSISDYSIIQ-AEKDGKAWVLMDFHQPQLVR 246
gi 524597049  199 KFYRDIAVVGVKLSD----KdinlkelhpvitssGCDATgeemLERITGDSVGDYLDVK-TDKNGKCWIQYEFAEPQTIK 273
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  268 SATVSIpg----aKGTFSg----PTVQMHLEASDDGQAWRKVADFPV-----TA-A--PST----VGFPAVTARQFRLVL 327
gi 283815469  230 SLAFLSkp----lGKPRPsggfgGGPQLTLEVSDDGQQFRKLTSIGT-----GR-S--SELslslAEFPAAKAKFFRITS 297
gi 506289997  238 SLTIYPaa----yQ---------MTASAELQIREAG-GYRTIRSFEI-----DR-RrnALN----VGFDPYAAIVISFPA 293
gi 503429095  237 SLTITPa---------TQa----MTLHVRLQVAVDT-GYREIKSFKI-----DR-SnsQLN----VGFEPYAPVSVSFAA 292
gi 361059282  220 SLQITPg------NDP-------VTADCDLEAINDKGAWQRITHLHI-----DR-S--NMD----IAVGPM--RYGPVVI 272
gi 177841308  259 AITLGGs------gG-SAk----GIPVGRVLASDDGVSFRPLVTLPGaqlyrQG-M--VRT----FALPETTARFYRIEL 320
gi 503603010  273 SATVFVpn----vRIPFAg----AAFAGTLESSQDGKTWTPIKALEL-----SN-V--PTT----ISFAPVEAAHFRLVL 332
gi 506376227  266 AITLVTqnpdrivSMIYGi----AAPKKVLEASDNGQTWRTVARLDT-----GDsP--ETT----ISFAPVTARYFRVTF 330
gi 524576385  247 SVTWSVlk----iEERVE------NCAASLFCSMDGKTFTKVVDLSY-----QGgF--ERV----EDIPQTTARYFKMVF 305
gi 524597049  274 AVVVSe------lRKDTNp----YVHTKELQYSDDGVNFKSINLSYQ-----AT-A--QRT----YAIPATTAKYFRLSL 331
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  328 APLPFN-GSNMGdp-mPGLAPvggfVEm----mAAAAKAPFDvkqfrlSSDVMVDQFESK--------AGFAVVPDYYAL 393
gi 283815469  298 --------PG-----------------------------ARQfaqlrfSGAARLADWRKK--------ANS-AFGVMGVT 331
gi 506289997  294 ST---S---KHFrl-vLKKSm-----------lAGQSFPKYGirefilSSVPRVERYVEKtfak-mvqTPLPYWNEYQWP 354
gi 503429095  293 V--RAKkF------------------Rl----vFTEVSENAAlaeiilSPLPRVARFKEKvlak-mhpTPLPYWHDYLWE 347
gi 361059282  273 SF------PAVK----AQTFR----LRf-------TNGKGGKlreielSGAPRLTAYVEKqlgkmwpyAE-VRPDSYTWP 330
gi 177841308  321 TGAPLGpAQ----------TM----SQa----pSAP-AKEYVlseavlHSGARVHRWEEK--------AGFSFLFEYETV 373
gi 503603010  333 NPGQp--DAALGsp-aPGVAG----NDlfgaiaSKRAGQPIMvgqfelHSDALVDRYETK--------AGFVMSRDYYAL 397
gi 506376227  331 HRGIAPpPPAWAkgvdPRSFG----LK------AETAPTGYKiaelvlHTGARVNHFEQK--------AAFVPTAGLDRF 392
gi 524576385  306 TSTE-KnNPA----------------------------TGFRlsslklSPVVRVNLLSDK--------SASSFYRYGTSV 348
gi 524597049  332 KDNKGK------------------------------KDCEFGiaqfalSTVTRIQLAGDK--------AGNSF-YRLLWM 372
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  394 GTPDAA-AA-GIDPKQVIDLTGRMKPDGTLDWTAP---KG-NWRIIRLGSSLLGTTNHPAPPEATGLEVDKFDGDAVRRY 467
gi 283815469  332 PDQDGSsKA-AIKLDSLVDLTRFVK-DGILTWTAP---AG-NWTVLRMGYTPNGEMNRSAPDTGVGLECDKYSAVAIDFH 405
gi 506289997  355 QQLVVGdKNlLIEPKNVLDVSRFMSPDGNFNWDAP---AG-DWVIMRMGMTPTGVNNSPASREGTGLEVDKMSKEHLRSH 430
gi 503429095  348 TQAPVDdAVqLTKPTTVLDITDKMDADGALIWDAP---KG-DWIVLRTGMVPTGVKNGPASPEGTGLEIDKMNHLHVVQH 423
gi 361059282  331 ATAEPEhKSlVVDPARVIDLSTKVDKSGNLNWAVP---AG-EWIILYTGMTPTGVTNSPTTTEGSGLEIDKMNKQLAQFH 406
gi 177841308  374 ATPEIApAL-AVAPDDLVDLTAKLQPDGSLEWDAP---PG-RWTILRLGYSLTGAKNRPATPAGTGYEADKLSRRHMEAY 448
gi 503603010  398 VGPHDN-VT-GVDPDSVIDLTDKLKADGTLDWAAPklpAGqHWRVLRLGYSLLGTTNHPAPPEATGLEVDKFDGEAVREY 475
gi 506376227  393 PTPAYAsDA-AVRPADVIDLTSKVKTDGTLDWTPP---PG-RWAILRFGYSLLGITNHPATIESTGLEVDKLNGNDVHQY 467
gi 524576385  349 K--TPAtTD-VVNTADVVDVTSFVK-DGVLTWKAP---KG-RWRIMRFGYGLTGKTNHPASPEATGLEVDKIDPVAIRDY 420
gi 524597049  373 EDTPYS-SE-AARLEDVVDLTPYVK-DGTLTWNAP---EG-NWRIFRFGYSLTGKTNHPASPEATGLEVDKLDPKAITEY 445
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  468 LEHYIGMYKDAAGSElvGKRGVRAILTDSIEVGAANWTPRMVEQFKRLRGYDPTPWLPTLAGVLVGTRAQSDGFLRDYRQ 547
gi 283815469  406 FNKMMENLLPTLGPm--AKKGRVGMLIDSYEVGMQNWTAQFPQAFQARSGYSLLNYLPAFTGRIVGDVDTTERFLWDVRR 483
gi 506289997  431 FDSFLGEILRRIPAA--DRKTWKVVVQDSYETGGQNWTDGLIEKFKARYGYDPLPYLPALQGKVVGNPDMSDRFLWDLRR 508
gi 503429095  424 FDAFLGEVMRRIPPA--DRKTFKVAVQDSYEMGGQNWTDNFIEKFKKQYGYDPVPYIPVMYGYVIGSQDESDRFLWDLRR 501
gi 361059282  407 FDAFIGELLKRTPAE--DRVALRHVVADSYEKGSENWTDGLGEDFKRTYGYDPYPFLPVLTGRIVASADRSDRFLWDLRR 484
gi 177841308  449 VRGYFDPLQQALGPLf-GK-SLRYVTMDGWEAGTNNWTDELPAEFRRRRGYAPTPYLPALTGRIVGSADVSDRFLWDFRR 526
gi 503603010  476 LEHYIGMYKDAAGPDmvGKRGVRALLTDSIEVGEANWTPRMLEQFQRLRGYDARPWLPALTGTLVGTREQSDRFLYDYRR 555
gi 506376227  468 MEAYLDSYKSAVGAAnmGARGITSVTNDSWEAGSENWTGDMIQQFRKLRGYNPIPWMPVLTGVVVGSPAQSDRFLWDFRQ 547
gi 524576385  421 YKNYLQTYVDASKGLm-GNRGITYLLNDSYEAGAQTWTGKMVEEFKARRGYDILPWLPALAGIVVNSAEETERFLFDWRT 499
gi 524597049  446 FHNYLQTYVEASGGKl-GKGGIEYLLTDSYEAGAQTWTRNMFEEFKARKGYDLLRWMPALTGMVLNNTEETERFLFDWRR 524
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  548 TLADLMASEHYGTVARVAHENDLKVYGEALEDNrpSLGDDIAMRSHADVPMSALWTFSRKAG-P-N-PSYIADMKGAAST 624
gi 283815469  484 TQADLIADNYYGRFRELCHKNGITAYTEPYDRG---PMEEMQIGARVDVNMGEFWNGLSAIFqN-N-LTMRRTTKLAASI 558
gi 506289997  509 FIADKVAYDYVGGLREISHQNGLRTWLENYGHWg-FPGEFLQYGGQSDEVAGEFWAAGE--L-G-N-----IENRAASSA 578
gi 503429095  502 FIADKVAYEYVGGLRDISHKHGLSIWLENYGHWg-FPGEFLQYGGQSDEVGGEFWSEGD--L-G-N-----IENRAASSA 571
gi 361059282  485 LVADRIASNYVGGLRERCQQNGLRLWLENYGHWg-FPGEFLSYGGASDDLGGEFWYGVPSLG-P-------VEVRCASSA 555
gi 177841308  527 TLADLWAEAHYGTMAEKLRERGVGIYAEAAGVSleMPEDTLLNKSKVEIPMGEFWVRDL--H-P-R-LMYLQDIRGAASA 601
gi 503603010  556 TLADLLASEHYGTVADVAHENDLKVYGEALEDHrpMLGDDMAMRSHADIPMAALWTFNRDEG-P-R-QTLIADMKGAASV 632
gi 506376227  548 TIGDLIATQHFGVIQKVLDQWHLTHYCESDESGraFVADGMRVKKHCQVPMGAMWTQTLSTN-NvQ-YNYNADDRESASV 625
gi 524576385  500 TIGDMMTEYHYDQLTDILKPYGLKRYTESHEAWraNATDGMDCKRSADIPMSAIWMRYKQGL-V-TvPQHESDIRESASV 577
gi 524597049  525 TIGDMISEYHYDLQNEILKPYGMKRYTESHENYraNLSDGMDCKRYAEIPMSAFWMDYKNEKiF-N-PRFEADVRESASV 602
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  625 AHIYGQ----------NLVAAESMTSA--L---APWAYAPNELRRIIDLEFASGVNRPVVHTSVHQPVDdKVPGMSLMIF 689
gi 283815469  559 AHINGHavgggtpdnpQVVGAEAFTGEpeS---ARWQEYPFAMKALGDKMFTQGLNKIIFHRYAHQPHPtAVPGMTMGPW 635
gi 506289997  579 AHIYGK----------TKVSAESFTAG--G---KPYIRYPAYIKQRGDRFFTEGINNTLLHVFIQQPDE-RMPGVN-ANF 641
gi 503429095  572 AHIYGK----------NKVSAESFTAA--G---NTYGRYPALMKQRGDRFFTEGINNSLLHVYIHQPYEdKRPGMN-AWF 635
gi 361059282  556 GHTYGK----------KVVSAEAFTSG--L----SFTQMPRNLKTRGDWAWSEGINHFVMHVYIHQPDD-RKPGMS-AWF 617
gi 177841308  602 AHVYGK----------PLVAAEAFTGG--G---Y---EAPATLKNVGDTWLAQGVNRIVFHTSAHQPLD-TKPGNM--MV 660
gi 503603010  633 AHLYGQ----------NLVAAESMTAS--M---APWAFAPKDLKRFIDLEFVTGVNRPVIHTSVHVPVDdKKPGLSLAIF 697
gi 506376227  626 AHIYGQ----------NLTAAESMTAA--A---DPWAWSPATLKPTADQEFLNGINRFFIHESAHQPLLnKKPGLTLGPF 690
gi 524576385  578 AHIYGQ----------NVAAAESFTSD--GfrdGAFVYTPAVLKPTADAAMASGLNLFVIHTSPHQPVDdKVPGIGLGLW 645
gi 524597049  603 AHIYGQ----------NIAAAESFTSD--GyrdGAWVFSPAVLKPTADAAMAAGLNRFVIHTSPHQPVDdKVPGLGLGKY 670
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  690 GQYFNRHEAWAELARPWVDYMARSSLLLQAGRNVADVAYFYGEEGP-LTA-LYgrkrIeDAPKVHAYDFINRDALFDAVE 767
gi 283815469  636 GIHFDRTTTWWNQGRSWLDYIARCQSLLQQGLFVADLAYFTGEDGNqYTK-VEphelTpTPPEGYDYDLINAETIIKRAS 714
gi 506289997  642 STEFNRHNTWFNYLDLFTAYLKRCNFMLQQGKYVADVAYFIGEDAPkMTG-ITe---P-ALPSGYSFDYINAEVIINRLS 716
gi 503429095  636 GNEFNRFNTWYADMDLFVDYLKRCNFMLQQGKYVADVAYFIGEDAP-KMT-GVq--dP-ALPKGYSFDYINGEVIRDRLK 710
gi 361059282  618 GTDFNRNNTWFTQSKTYFDYIRRSCALLQQGHTVADVAYFIGEDAP---K-MTgdkdP-ALPPGYNYDFINAEMLA-KAR 691
gi 177841308  661 GTHLHRNITWAEQARPIMTYFARSCFLLQQGRFVADLAYLLDEGAP-STPpIWgagtRpTPPAGYDYDFVNADVLLHRFS 739
gi 503603010  698 GQYFNRQESWAEMARPWVDYIARSSLLLQTGRNVADVAYFYGEEAP-LTG-LYgdepVaDAPVRYAYDYINFNALTELLA 775
gi 506376227  691 GQWFNRNETWAGEASPWIRYLARNSYMLQQGRFAADILYYYGQDTN-LTA-LYhdrsP-NLPNGYDFDYADADALLHVLG 767
gi 524576385  646 GQWFDRNETWASQAGAWTDYLARSCYLLRQGKFVADVAYYYGEDSN-VTA-RYqtrmP-KFPNTYNYDFVSPSIVKDVLK 722
gi 524597049  671 GQWFDRHQTWADQAKAWTDYLSRSCYMLQQGRFVADVAYYYGEDNN-ATG-IMlkkvP-ALPYGYNYDYFSPSVIRDLAK 747
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  768 VQ-GGEVVAKGGARYKAIQLGGsSRRMTLPTLRRLAALVEAGATVVGSPPEGSPALNDSA----ADFSALVAKLW-SGQL 841
gi 283815469  715 VS-NGNLALPDGMSYRVLVLQD-HKALSIELVRKLRELVNGGLILVGSKPATSLGLRAKTqg-nDEFQRLVAEIW-GADN 790
gi 506289997  717 VK-NGRLFLPDGMNYGLLVLPA-LETIRPELLEKIRNLVSQGAAVMGPAPKRSPSLEHYPla-dQHVSAMAKELW-GNIN 792
gi 503429095  711 VK-DGRFVLPDGLSYRILVLPK-LETMRPELLEKIEELVRDGGVILGPKPKRSPSLQHFGea-dKKLRDLADKLW-GNID 786
gi 361059282  692 VV-NDRIVLASGASYAVLVLPP-KETMRPEILKKIVALVADGACVLGNAPAHSPSGRDYPfc-dTRVQALAKELW-GFK- 766
gi 177841308  740 SGgNGKLMLPDGMSYRVLVLPD-TDRMRPELVRKLRELVLGGATIVGRKPTRSPSLADYPra-dAEVHALAAELW-GDLD 816
gi 503603010  776 ND-GEDLVAPSGARYKTIYLGGsSSHMTLAALRKLAALVVGGATVVGKAPIATPSNTSAQegdlTEWSSLVARLW-PGSG 853
gi 506376227  768 VNaAGEITTPGKVTYRILGLNQnSRHMSLPVLEAIHRLVMQGATVAGPKPTSDPSLSDDQ----AQFHALADQLFgDGTG 843
gi 524576385  723 VD-NGQLVTATGMRYRVLWLDN-VSMISIKMLRRIKQLADAGVTIAGDKPKTLVGLDGTV----EEFDSLVKDIW-GS-- 793
gi 524597049  748 AE-NGLLTVPSGMKYKVLMLDAnVKHMSIDILRKIKVFADAGVVICGAKPQKLAGNTGTE----EEFKALVKDIW-NT-- 819
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123763516  842 -----VTRVGAGQVIASADIDRALADAGIAPDLVLDGtSEDGEVLFVHRALPDGDAWFLNNRKAAPEVVEARFRVTGKQP 916
gi 283815469  791 v---tENRLGKGRVFRTQPMQTVLSALAIKPDFEVTSrSGDAPVTYIHRRIGKTQVYFLANQRRTPEELVCTFRVDGMQP 867
gi 506289997  793 gttitSRKYGKGQVLYGTDLSTALNRLNIVPDYKT---NHTDSILFIHRTTPEAEIYYVSNQKNKPVSVLSEFRVGNKQP 869
gi 503429095  787 akkikTYAYGKGLVMDGIDLQAALDSLQILPDVKLAD---RDTALFIHRRLDGGDIYFVSNQTDQAIRITPEFRVSDKVP 863
gi 361059282  767 -------MVGKGHVFTGIGLKKVLRQIGVAEDCVL-----GKDFLYTHRQEGNAHCYFVSNQLDIARKDTMAFRVTGLQP 834
gi 177841308  817 gvsrtVRRVGKGTVVWGLPRERVLSDEGIAKDFDADQ-PLDAEFAWLHRRAGEIDLYYVANLTDRTQAIDARFRVSGREA 895
gi 503603010  854 -----DARVGKGRVIASQDIESALQAMDVAPDFTFTGaDAGVKIPFVHRRDGKGEIYYLVNQQEAAQSIEAHFRVTGKQP 928
gi 506376227  844 -----IHHLGKGTVYAGSTVAEALVAMQAAPDFDCIPtVPGANVKFIHRKLPDGDIYFLDNRSDAPATVEASFRVDGRIP 918
gi 524576385  794 ---------GRKNVTTGVSIGKVLANTGVAPDVTFSD--AKANIKFVHRRLNDGEIYWIANQTKQARKFTASFNVTGKKP 862
gi 524597049  820 ---------GRKNVTAGVPAEKVLSAMSLKPDFSIAS-GNNKDIKFVHRNLSDGEIYWVTNLSKDTRDITASFRTTGKKP 889
                         970
                  ....*....|....*...
gi 123763516  917 ELWHADTGETEAI-SYRI 933
gi 283815469  868 ELWDAATGKQTPLtLYSA 885
gi 506289997  870 ELWDPVDGTTRALpQYEH 887
gi 503429095  864 ALWNAIDGSRRELpEFSQ 881
gi 361059282  835 ELWDAVTGQIKALpNYAI 852
gi 177841308  896 ELWHPDTGKIERV-GFTQ 912
gi 503603010  929 ELWHPETGKSEPI-SYRI 945
gi 506376227  919 ALWHSDTGSIDSV-SYTI 935
gi 524576385  863 QLWHADTGAKEDV-SYEM 879
gi 524597049  890 VIWHAEDASTEPV-SYEI 906
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap