4FE9


Conserved Protein Domain Family
DUF5115

?
pfam17142: DUF5115 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5115)
Statistics
?
PSSM-Id: 319161
View PSSM: pfam17142
Aligned: 4 rows
Threshold Bit Score: 362.688
Threshold Setting Gi: 524598851
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FE9_A         6 NEDFKDWADPQSNPQEESAGQLTATFTAGKDASIVMDAATADS-VEIAKLSSTTA-EeGSKIAVN---SLTLNENH-TIP 79
gi 492740327  21 NEDFKDWAAPQSNPQEDSAEQMTATFTTGQDANISMDEATADS-VEIVKLTSTTAvE-GSTITLS---SLLFNDDY-SLP 94
gi 524598851  21 NGDYDDWASPQTNSPEEAAAKYGVTFSAGEEADVNMATTQYDSyVNLVKITSSSA-N-ISDYAVK---SVSVNGQTvDAD 95
gi 492707998  21 DEDYTDWANPQSNPQEESKSGITAQ-VAGVTSEVVMDTYAEDS-VVIAKLESLS----GSDEIVGyklQLAGNDKTlDIP 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FE9_A        80 FSmTEDHVFKVALAQLDSVTQEAYKSRASVVRELKISINASAVTPSGEGIQLV-GNEVSITLQPATTPAVDPDGYYIVGD 158
gi 492740327  95 FT-TKDGTVKVALTQLDSITQEIYKSRASVARNLRVIVKAAATTPAGDGIQLS-GNEVNITLKPGATPAVDPKGYYVVGA 172
gi 524598851  96 YA---KGYIRVLAQDLDNIVETENNSRAGVKRNIDVKSTVSAILTNGDAVTIDmAGETTGSVTP-RPVNVDPQGYYLLGD 171
gi 492707998  95 FA-EKDGALKVDAAELELLTMQLYNSRQAVARDIAVKVGVSAMASDNQAVSVD-VADINMKVTPVTPPAMEDE-YYALGD 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FE9_A       159 F-------TGWDGNSAQQMKKDALDENLYILE--AEIESTSNFKIFPASA-INGNDIDWTKALGSSVDGDDSG-DNFVSW 227
gi 492740327 173 F-------TGWNAEGALPMTLDPNNKNVYTLEt-ETTEANQNFKIFPASA-INGKDIDWAQALGAQKDGDTAA-ENFLTW 242
gi 524598851 172 FkenskdgKGWQPTAPVYMKETAEGSGIYKAVv-NTIGDDSYYSIYGASSfVSGNWDEINKSVYGSPTADNSAtEGLLVY 250
gi 492707998 172 I-------SSWDLAGALAFTRDADDDAIFTLEftNEKEDKANFKIFPKSG-AAGS-IDWNKALGAMKDGDASA-SGLLDF 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
4FE9_A       228 T-----NA----GAINTALDGKIKISFDAFNYRFTVKDNS 258
gi 492740327 243 Kvg-dkEA----GAIMVEEAGKIKITINMTDFRYSVKDNS 277
gi 524598851 251 TgddvaHApngvKAMVIKGANKWQITFDANNLTYSVSRKY 290
gi 492707998 242 TdqkgqQA----GAIGLELQGKVRITINVKDYTYTIKEVS 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap